KEGG   Gallus gallus (chicken): 421884
Entry
421884            CDS       T01006                                 

Gene name
DST
Definition
(RefSeq) dystonin isoform X25
  KO
K10382  dystonin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    421884 (DST)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    421884 (DST)
SSDB
Motif
Pfam: Spectrin CH GAS2 Spectrin_like SH3_10 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 CAMSAP_CH Laminin_II
Other DBs
NCBI-GeneID: 421884
NCBI-ProteinID: XP_004940517
CGNC: 12181
Ensembl: ENSGALG00000016289
Position
3
AA seq 5692 aa
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATILFFCCWHRRLQKGRHPIKSVFSGRSRSR
DAVMRTHHFRSEVIYLARNFKGFRSSPRHARRRVAPRIEETQPLVEAHHLSEQETSVRKR
KIKKSSRVQPEFYHSVQVTPTRKPSSGTASYRCSMSSSADLSEEEDLSQKSGTGSPAPGD
TLPWNLPKHERSKRKIHGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVN
DLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVKLVNIRNDD
ITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWSQQTTEGYAGIRCENFT
TCWRDGRLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFFVAEKLGVARLLDPEDVDVSS
PDEKSVITYVSSLYDAFPKVPEGGEGISANDVEVKWVEYQNMVNYLMQWIRHHVTIMSDR
TFPNNPVELKALYNQYLQFKETDIPPKETDKLKIKRLYKLLEVWIEFGRIKLPQGYHPND
IEKEWGKLIIAMLEREKTLRPEVERLEMLQQIASRIQRDSRSCEDKLILARNALQADTKR
LESGLQFQHEAEIAGYLLESENLLRQQVIDAQILIDGKYYQADQLVQRVAKLRDELMAIR
TECSSLYSKGHALTTEQTKLMISGITESLNSGFTTNLTPDLNAAMTQGLTPSLTSSSLTS
GLSSGLTSRLTPAMTPAYTPGIPPRLIQSYVTGVDGGTLQTLKLMQIRKPLMKSAFVDQN
LTEEEVNMKFVQDLLNWVEEMQVQLDRVEWGSDLPSVESHLENHKNVHRAIEEFESSLKE
AKISEIQMTAPLKLSYAEKLHKLESQYSKLLNTSRNQERHLDTLHDFVSRATRELIWLNE
KEEEEVAYDWSERNPNITRKKEYHAELMRELDQKEEVIKSVQEIAEQLLLENHPARLTIE
AYRAAMQTQWSWILQLCHCVEQHLRENASYFEFFSDAKEAMEYLKNLKDAIYRKYSCDRS
SSLHRLEDLVQESMEEKEQLLQYKSTVAGLVGRAKAIIQLKPRNPDCILKTSIPIKAICD
YRQIEITIYKDDECVLANNSHRAKWKVISPSGNEAMVPSVCFTVPPPNKEAIDTANRIEQ
QFQNVLALWHESHVNMKSVVSWHYLTNEIEAVRAGNVASIKTMLPGEHQQVLSNLQSRFD
DFVEDSQESKIFTSSDTAQLEREVSICKQYYQELLKSAEREEHEESIYNLYISEVRNIRL
RLESCEERLIRQIRTPMERDDLHESVFRISEQEKLKKELDRLKDDLGVITDKCEEFFSQA
AGSPSVPTLRSELSVVIQNMNQVYSMSSIYIDKLKTVNLVLKNTQGAESLVKLYETKLCE
EEAVTADKTNIENLMGTLKQWRSEVDEKREVFHALEDELQKAKMISDQMFKTHKERDLDF
DWHKEKVDQLAERWQNIHSQIENRLRDLEGINKSLKYYKDTYDSLDTWIQQVEDTQRKIQ
EIRPENSKALAKQLNQHKMLVSEIEMKQSKIDECQKYAEQYSAAVKDYELQTMTYRAMVD
SQQKSPVKRRRMQSSSDFIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEERSMEE
EKKEHVEKAGDLLKWVSNLSKTLSKEGGEKAEKTDLPKQQISLEEMSAKKEQIAEALQTT
QAFLAKHSDKMTDEERGEMEKQVKSLQESYSLLSHEALKQLQEAQYLDDEKMEEKDVAER
QQECKEKLQEICDMLTQTENRLIGQQESLLIGDSKAELEQYQTKQEEIQKDMRASAQTLA
EIVKNTENFLKENGGKLSQEDKAVLEQKLNEAKTKCLLLSQKAEESKKELDKAMTTAIKQ
ETEKVAAIEQLEESKNTIENLLDWLSNVDKEAEHGRKFKQAIEQNGTHFEEGDVKALEGE
EDDVNGNLLEIQQDIETQVDGLVKSTEDNLNQQYQKVKAQHEKIISQQQAVIIATQSAQA
LLEKQGHYLSPEEKEKMQRNMKELKAQYETALAESERKMKMTHSLREELEKFDTDYNEFE
TWLQQAEQELDNLEAGASDFSGIMVKLKRQKSFSEDVISHKGDLRYITISGQRVLDAARS
CSKRDGVKVDKDGIDTSATYTEVQNKLDSASDRFKSLYTKCSILGNNLKDLADKYQHYED
ASSGLLSGLQASEVAVNKQLSEPIAVDPKNLQRQLEETKVLQGQVSNHQIAVEKLKKAAE
VLLDSRGELASDKEEIQKTLDDIVERYDNLSKSVNERNEKLQITLTRSLSVQDGLDEMLD
WMEGVEKSLEEQDQVPLNSAAIQDIISKSIMLEQDIAGRQSSINTMNEKVKKFMETADPS
TASSLQAKMSELAGRFSAASKKHKEKLMKMEELKTKVELFEGLSEKLQSFLDEKNQALSE
TEAPRKDVSEVSQYMQEASVELAKHKKDLEVLQNLLEELSLHALPGDKALVLEKVNALSK
KFREVEETVKEKEEDVSSCQKEIDSFELLVESLKKWIKETTERIPAAQPSLNTEELKKPL
EDTLNLKDEWTLKATELQKMNSRGTLLCSLISAVTSPAKLRAVAKSGGTVLNGEGGAPGT
QDFLKNKELTSVQQAMSDVNHSYEDLGVSLKKKISELESMLSKMQNIQEESTSMMQWLQK
MDKTASDWEAAPTDSEAVKAQVEQHKLFETELKQSENKVQELKDKVTELLEKNPNSPEAP
KWRQVLDKIDSKWKELNQVTSERQQKLEESSNYLTQFQTAEAQLKHWLVEKELMVSVLGP
LSIDPNMLNTQKQQVQILLKEFDTRKPQYEQLTVAGEGILKRPGEHPPSHEIVKEQLAAV
AQKWDNLTSQLSNRCDRIDQAIVKSTEYQSLLRSLSDKLSALDSKLSSSLAVSTQPDAVK
QQLEIAKEMKKEIEQEMKNINAAQVLCEELSTLVGEEYLKAELTRQLDGILKSFKDIEQK
SDNHVQQLQSAYTTSHQFQQTSKDFQAWLDGKKEELKQARPISAKLETLQSLIEEQKDFM
KTLTNEISSYEKIVAEGESILQKTQGADKAALQDQIATLRSNWDEMDKEVKERQGKLADC
LEKALKYKQHVESLQPWIEKCQSNLSELKVGINPVEIENSVVQVRAWQKDLDKHHGIVEL
LNNTAESLLSASQTDKEIVKEETKVLNEKVSMVTEQLHKKRECLENMAQRLKEFQESSRE
TEKQLQSAKEHLEAHDSLGPQSFSNKHLTMMQAQQKALQALRPQVDLVKKLAQDLVVEAS
DSAGVSDLLLQAESLEQEYTAVNQQVEDRCSFLETKLQGIGHFQNSIREMFSQFAEFDDE
LDSMAPVGRDLDVLQSQREDIKHFLKKLEDLIMNNENANKNCKMMLATEAEASPDLVGIK
RDLEALNKQCNKLLDRAKAREDQVEGTINRVEEFYSKLKEFSSLLGRAEEHEESQGPVGM
ETETINQQLNTFKVFQKEEIEPLQVKQQEVNWLGQGLIQSAAKSTNTESLEHDLEDVNTR
WKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWLIDTEELVANQKPPSAEFKVVKAQI
QEQKLLQRLLDDRKPTVEVIKREGEKIAESAEPADKVKILKQLSLLDSRWDALLSKAETR
NRQLEGISVVAQQFHEALEPLVEWLSATEKRLANAEPIGTQASKLQQQISQHKALEDDVL
AHNKSLLQAISIGQSLKTMSSREDKDMVQEKLDSSQARYIEIQEKSNSRSELLQQAYCNA
QIFGEDEVELMNWLNEVHDKLSKLSVQDCNTELLEKQHSELLELQEEILLRKQNVDLAIQ
NGLELLKQTTGDEVIIIQDKLEGIKVRYKDITKLSSDVSKTLEQALQLAGQLHSTHEELC
KWLDKVEVELLSYETQMPKGEELSQAQERQKELKQEAKNNKALLDTLNEVGSAFLELVPW
RAREGLDKMITEDNERYRLVNDTISQKVDEIDAAILRSQQFDQAADAELAWIAEAEKKLM
SLGDIRLEQDQTAAQLQVQKAFTMEILRHKDTIDELVKSGDKIMNTCTEEEKQTIKKKLK
SLLQKYDTVCQMNSERNLQLERAQSLVNQFWETYEELWPWLTETEMIISQLPAPALEYET
LKQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSKIKED
VKKRALALDEALSQCTQFHDKIDPTLESLQRIVERLRQPPSISAEVEKIKEQISENKNVS
MDLEKLQPVYETLKQRGEEMIARSEGADKDVSAKVVQDKLDQMVLIWQDIQTLTEEREAK
LLDVMELAEKFWCDHMALVATIKDTQDFIRELEGPGVDPSVVKQQQEAAEAAKEEIDGLQ
EELESVVSLGSELRAACGEPDKPIVNKSIDELNSAWDALNKTWKERVDKLAEAMQAAVQY
QDGLQAIFDWVDIAGIKLASMSPVGTDLETVKQQTEELKQFKTEAYQQQIEMERLNHQAE
LLLKKVTQESDKHTVQDPLSELRIMWDSLEEKIINRQHKLEGALLALGQFQHALDELLTW
LTHTEDLLNEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVKKAGSDLIESSAVEE
ASNLRSKLELLNQRWQNVLEKTEQRKQQLDSALIQAQGFHGEVEDMQQWLTDTERQLLAS
KPVGGLPETAREQLNTHMELCAAFEAKEETYKCLMQKGQQMLARCPESAETNVEQDINNL
KEKWESVQTKLGERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLTAASRPSLILDTVL
FQIDEHKVFATEVNSHRDQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRL
VERGRALDDARKRAKQFHEAWHKLMEWLEESEKSLDSDLEIANDPDKIKMQLAQHKEFQK
SLGAKHSVYDTTNRTGRSLKEKTTLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEA
LLFSGQFTDALQALIDWLYKIEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQ
ALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSVSKQTRLEQALRQAEEFHSVVH
VLLEWLAEAEQALRFHGVLPDDEEALRTLIDQHREFMKKLEEKKAELNKATGMGEAILAI
CHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLAGALAGLIANQELLEALLSWLQWAET
TLTEKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRKALEPTPVQSHIP
VLDKGRAGRKRSPTPGLYPSAAQAQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDR
LEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFP
TSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCA
KRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRA
KGRTNVELREKFILADGASQSMAAFRPRGRRSRPSSRGASPNRSTSLSSQAGQAAAPQAV
ATSTPKTPHHLTRNYGKPWLTNSKTSTPSKPPESSDYQGSSGEGTPIQGSKLRLPGYLSG
KGFHSGEDSGILSTAATRVRAQFAETRRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISE
IQSVCSDMSETVPATSRPTPRAGSRPGSAKPSKIPTPQRRPIASKLDRSLKR
NT seq 17079 nt   +upstreamnt  +downstreamnt
atgatcgcggcggcgttcctggtcctgctgagaccctacagcatccagtgcgccctcttc
ttgctcctgctgctgctgggtaccatcgccaccattctattcttctgctgctggcaccgc
aggctgcagaagggcagacaccccatcaaatccgtcttctcgggccgctcgcggagccga
gatgctgtcatgagaacgcaccactttcgctctgaggtaatttatttagcacgcaatttc
aagggctttagatcaagtcctcgtcatgccagaagacgtgtagcacctcgcattgaggaa
acacagcctttagtagaagctcaccatctaagtgagcaggaaacctctgtaagaaaaagg
aaaatcaagaaaagcagccgagtgcaaccggaattttatcattctgttcaagtgactcca
actcgaaaaccaagctccggcaccgcgtcctaccgctgctccatgtcgtcctccgccgat
ctctccgaggaggaggacctcagccagaagtcgggcacggggtcgccggcgccgggggac
acgctgccctggaacctgcccaagcatgagcgttccaagcggaagatccacggcggctcc
gtgctggacccggccgagcgggccgtgctgcgcatcgccgatgaacgggataaagtacaa
aagaagaccttcacaaaatggataaatcaacatctcatgaaggttcgaaaacatgtgaat
gacctctatgaagacctaagagatggacataacttgatctcacttttagaagtcctttcc
ggagacaccctgccccgagaaaaaggtcggatgcgttttcacagactccagaacgtccaa
attgcacttgactatttgaaaaagcgccaggtgaaactggtcaacattaggaatgatgac
ataacagatgggaatcccaagttgactttggggttgatatggaccataattttgcacttt
cagatatctgatatccatgttactggagagtcagaggacatgtctgctaaagaaagattg
ctcctgtggtcacagcagacaactgagggttatgctggaatccgttgtgaaaatttcact
acctgctggcgtgatggaagattatttaatgccatcattcataaatacaggccggacctg
atagacatgaataccgttgctgttcaaagcaaccttgcaaatttagaacatgcttttttt
gtagcagaaaaacttggtgttgccagacttctggatcctgaagatgttgatgtttcctca
cctgatgagaaatcagtaataacttatgtgtcatcactttatgatgcatttcccaaagta
ccagaaggtggtgaaggcatcagtgcaaatgatgttgaagtcaaatgggttgaatatcag
aatatggtgaactacctcatgcagtggatcaggcaccatgtcacaataatgtctgacaga
acatttcccaacaatcctgtggagctgaaggcactttataatcaatatttacagtttaaa
gaaacggatattccacctaaggagacagataaattaaaaattaaacgtctatataaactg
ctggaggtctggatagaatttggacgcatcaaacttcctcaaggctatcatccaaatgat
atagaaaaagaatggggaaagcttattattgccatgctggaaagagagaagactcttagg
cctgaagtggagaggttggaaatgctgcagcagattgcaagcagaattcagcgagacagc
cgaagctgtgaggacaaactgatacttgcccggaatgctctgcaggctgacaccaaacga
ctagagtcggggcttcagtttcaacacgaagcagaaatagctgggtatcttcttgaatct
gagaaccttctccgccagcaagtgattgatgcccaaattcttattgatggaaagtactat
caggcagaccagcttgtacagagggttgcaaaacttcgtgatgaactgatggccatacga
accgaatgttcttctttgtacagcaagggacatgcactgacaacagaacagacaaagctg
atgatatcaggaataactgaaagtttaaactcaggatttacgacaaacctaactcctgac
ttaaatgctgcaatgactcaaggcttaacacctagtttgacttcttccagtttgacatct
ggcctctcatcaggtcttacttccaggctgacaccagccatgactcctgcttacacacca
ggcatcccaccgcggttaattcagagctatgtaacaggagtagatggtggaactctgcaa
acactcaaacttatgcaaatcagaaaacctcttatgaaatcagcttttgtggaccagaat
ttaacagaagaagaagtgaacatgaaatttgtccaggacctattgaactgggtggaagaa
atgcaggtgcaacttgatcgagtggaatggggttcagatttaccaagtgttgaaagccat
ttagaaaatcacaaaaatgttcacagggctattgaagaatttgaatccagccttaaagaa
gcaaaaatcagtgagatccaaatgactgcccctctgaaactcagttatgcggaaaaattg
cacaaactggaaagtcagtattcaaaactcttgaacacatcaagaaatcaggaaaggcat
ctagatacccttcacgattttgtctctcgtgctactagagagctgatatggctgaatgaa
aaagaagaggaggaggttgcatatgattggagtgaaagaaaccccaatataacaagaaaa
aaggaataccatgcagaattaatgagagaacttgatcaaaaagaagaagttattaaatca
gtacaagaaatagcggaacagttgcttcttgaaaatcacccagccaggctaaccattgag
gcctacagagctgcaatgcagacacagtggagctggattcttcagctctgtcactgcgtt
gaacaacatttgagagaaaatgcttcatattttgagtttttcagtgatgccaaagaggcc
atggagtatttaaagaatttgaaagatgccatataccgaaaatacagttgtgacagatca
agcagccttcataggctggaagaccttgtccaggagtctatggaagaaaaggagcaactc
ttgcagtataagagcacagtagcaggccttgtggggagagcaaaggcaataattcagctg
aagccaaggaaccctgactgtatactgaaaacatccattccaattaaagccatctgtgac
tatagacaaattgagataacaatttacaaggatgatgagtgtgtgttagcaaacaactcc
catcgtgctaaatggaaagtcattagcccaagtggtaatgaggccatggttccatctgta
tgctttacagttcctccaccaaacaaggaagcaatagatacagccaacaggattgaacag
cagtttcagaacgttttggccctttggcatgagtcgcatgtaaacatgaagagtgtggtt
tcctggcattacctaacaaatgaaattgaagcagttagagctggcaatgttgcttcgata
aaaacaatgctaccaggtgaacatcagcaggttctaagcaatttgcagtcccgctttgat
gattttgtggaagatagccaggagtccaaaatctttacaagctctgatactgcacaactg
gaaagggaagttagtatttgcaagcaatactatcaagagcttctgaagtctgcagagaga
gaggagcatgaagaatctatttacaatctgtacatctccgaagtcagaaatatcagactt
cggctggagagttgtgaggaacggttaatccgacagatccggaccccaatggaaagagat
gatctacacgaaagcgtctttaggatttcagagcaagagaaactgaagaaggagctggat
cgactgaaggatgacttgggagtcatcacagacaaatgtgaagagtttttcagtcaggct
gctggatcaccttcagttcctactctgcgctctgaactcagcgttgttattcagaatatg
aaccaagtttattccatgtcttccatttacatagacaaattaaaaactgtaaatttggtg
ctgaagaatactcaaggtgcagaatcattagtaaaactttatgaaactaagttatgtgaa
gaagaggcagtaactgctgacaaaaccaatattgaaaatctaatgggtacattaaagcaa
tggagatctgaagtagatgagaaaagagaagtgttccatgccttagaggatgagctgcag
aaggcaaagatgatcagcgatcagatgtttaaaacgcacaaggaacgtgatcttgacttt
gactggcataaagaaaaagttgatcagttagccgagaggtggcaaaacattcattctcaa
attgaaaataggttacgtgacttagaaggtattaataaatctctgaagtactacaaagat
acttacgattcattggacacttggattcaacaagtggaagatactcagaggaagattcaa
gaaatccgtcctgaaaatagcaaagcattggctaaacagctgaaccaacataagatgctg
gtttctgagattgaaatgaaacaaagcaaaatagacgaatgccagaaatatgcagaacag
tactcagctgctgtgaaggactacgagttgcagactatgacttacagagctatggttgat
tcccaacaaaaatctccagtgaaacgacgaagaatgcaaagctcatcagacttcattatt
caagagttcatggatttacgaactcgttatactgccttagtgactttgatgacacagtac
atcaagtttgcaggtgactctctgaaaaggctggaggaggaagagaggtcaatggaagaa
gaaaaaaaagaacatgttgagaaggctggggatttactgaaatgggtgtcaaacctcagc
aagacactcagcaaagaaggaggagaaaaggctgaaaagacagatttgcctaagcagcag
atttcccttgaagaaatgtcagctaagaaggaacaaatagctgaagctctgcagactact
caggcatttttagctaaacacagtgacaaaatgacagatgaagagagaggtgaaatggaa
aaacaagtcaaatccctccaggagagctacagtttgttatcccatgaagctttgaagcag
ctgcaggaagcacagtatttggatgatgaaaagatggaagaaaaggacgtggctgaacgg
cagcaagaatgcaaagagaaactgcaggaaatatgtgatatgcttacacagactgaaaat
cgacttattggacagcaagagtctcttcttattggagacagcaaggctgagctagaacaa
taccagaccaaacaggaggagatacaaaaagacatgagagcaagtgcccagacattggca
gagattgtgaaaaatactgaaaacttcttaaaagaaaatggaggaaagctgtcacaagag
gacaaggctgttcttgaacagaaactgaatgaagcaaagaccaaatgtttgctccttagc
caaaaggcagaagaatctaaaaaagaactggataaagctatgacaacagcaattaagcag
gaaacagaaaaggtcgcagccatagaacagctggaagaaagtaaaaatacgatagaaaac
ctcttggactggttatcaaatgtggataaagaagcagagcatggcaggaaatttaagcag
gcaatagaacagaatggaacacactttgaagaaggagatgtgaaggctttggaaggggag
gaggatgatgtcaatggtaatctgctggaaattcagcaagatattgaaactcaggtggat
ggactagtaaaaagcacagaagataacctgaaccagcagtatcagaaagtcaaggcacaa
catgagaaaattatttcacagcagcaggctgtcataatagcaactcagtctgctcaggca
ctactcgagaagcaaggacactacctttctcctgaagaaaaagagaagatgcagcggaac
atgaaagagctgaaggctcagtatgaaactgcattagctgaatcagaacggaagatgaag
atgactcattctctgagggaagaacttgagaaatttgatacagactataatgaatttgaa
acctggctgcagcaggcagaacaggagcttgacaacttggaggctggtgcttctgacttc
agtggtattatggtcaaactgaaaaggcagaagagtttttcagaagacgttatatctcac
aagggtgatttacggtatattacaatttctggacaaagagttttggatgctgcaaggtca
tgtagcaaaagagatggagtcaaggttgacaaagatggtattgatacttctgctacttac
actgaagtgcaaaataaactagatagcgcttcagatcgttttaaatctctctatactaag
tgtagcatccttggaaataaccttaaagacttggcagataaataccagcattatgaagat
gcttcatctgggcttctgtcaggtcttcaggcctctgaggtagctgtgaacaaacaacta
tctgagccaattgctgtggatcccaaaaatctccaaagacaactagaagaaaccaaggtt
cttcaaggacaagtgtctaaccaccaaattgctgtagaaaaacttaaaaaagctgctgaa
gtgcttttggattcaaggggggagttggcatcagacaaagaggagattcagaaaacgctg
gatgatattgtggagagatatgacaatttatccaagtctgtgaatgaaaggaatgagaag
ctccaaataacattgactcgatccctaagtgtgcaggatggtttggatgagatgctggat
tggatggaaggtgttgaaaagagccttgaagaacaagatcaagtgcctttgaattctgct
gctattcaagatatcattagtaaaagcattatgctagaacaagacattgcaggtcgtcaa
agcagtataaacactatgaatgagaaggtgaagaagttcatggaaacagcagatccatcc
actgcgtcctcactgcaagccaaaatgagtgaacttgcaggacgtttttctgcagcaagt
aagaagcataaagaaaaacttatgaaaatggaggagttgaagactaaagtggagttattt
gaaggtctgtcagaaaaactccagtcattcctagatgagaaaaaccaggctctcagtgag
actgaggcaccaagaaaggatgttagtgaagtgtctcagtacatgcaggaggctagtgtg
gaattagcgaaacataagaaagacctggaagttttgcagaaccttcttgaagaactatct
ttacatgcacttcctggggataaagcactggtactagaaaaagtaaatgctttgtcaaaa
aaattcagagaggtagaggagactgtgaaggaaaaagaagaggatgtatcatcttgtcag
aaagaaattgatagttttgagctacttgtagaatctttaaagaaatggataaaagagaca
acagaacgaatacctgctgcacaaccctctctgaatacggaagagttaaagaagcctctg
gaagatacattgaatttaaaagatgaatggacattaaaagcaactgagctgcagaaaatg
aacagcagaggaacattgttatgtagtctgattagtgctgtgacttctcctgcaaaactg
agagcagttgcaaaatcaggtggcacagtgttgaatggtgaaggaggagctccaggaact
caggattttctgaaaaacaaagaactgacaagtgttcaacaagccatgtccgatgtaaat
catagttatgaagatttgggagtttcactgaagaaaaagatttcggaactagaaagtatg
ctttcaaaaatgcaaaacattcaagaagaatcaacttcaatgatgcagtggttacaaaaa
atggacaaaactgcatcagactgggaagctgctccaactgacagtgaagctgttaaagcc
caagttgaacaacataagctatttgaaactgaattaaagcaaagtgagaataaagtgcag
gaactaaaggacaaagtgacagagctattggagaagaaccccaactctcctgaagcaccc
aagtggagacaagtgttggataaaatagactccaagtggaaggagctcaatcaagttaca
tctgagagacaacaaaaactggaagagtcttcaaattacctgacccagttccagactgca
gaagctcagttaaagcactggcttgtggaaaaggagctaatggtcagtgtgctgggacca
ctgtcaattgaccccaatatgctgaatacacaaaagcaacaggttcagattctgctcaaa
gagtttgacaccagaaagccacaatatgagcagctaactgtggctggtgaggggattctg
aagagacctggtgagcatcccccctctcatgaaattgtaaaagagcagctggcagctgtg
gcacaaaaatgggacaacctaactagccaactgagtaacagatgtgaccgaattgaccaa
gctatagtgaaaagtacggagtatcaaagcctactcagaagtctgtctgataagctaagt
gccttggatagcaaactgagcagcagcctggctgtgagtacacagcctgatgctgtgaaa
caacaactggagattgctaaagaaatgaagaaggaaatagaacaggaaatgaagaatata
aatgcagctcaagttctttgtgaagagctctcaacactggttggagaagagtatttgaaa
gcagaacttacaaggcagttagatggcatcctcaaatcatttaaggatattgagcaaaaa
tcagataatcatgttcagcagcttcagtcagcatataccacttctcatcagttccagcaa
acatctaaggactttcaggcctggctagacggaaagaaagaagagctgaaacaggctcgt
cctatatcagccaaacttgagaccttgcagtccctaattgaagaacagaaagattttatg
aagacccttaccaatgaaattagttcatatgaaaaaattgttgcagaaggagaaagtata
ttacagaagactcaaggagctgataaagcagctttacaggatcaaattgccacactgaga
agtaattgggatgaaatggataaggaggtaaaagaaaggcaaggtaaattagcagattgt
ctggagaaagcactcaaatacaagcagcatgtagaaagtttgcagccatggatagagaaa
tgccagagcaacctgtctgaattaaaagtcggcataaaccctgttgaaatagaaaattct
gttgttcaggtgagggcctggcagaaggacctggataaacaccacgggatagtggaacta
ctaaataatactgctgaaagtttgctcagtgcaagtcaaacagataaagaaattgttaaa
gaagaaactaaggtactgaatgagaaagtgagtatggtcacagaacagttgcataagaag
agagagtgcttggaaaatatggcacaaaggctaaaagagtttcaggaatcatccagggaa
acagaaaagcagcttcaaagtgctaaagagcacctggaagctcacgattcgcttggacct
cagtctttcagtaacaaacacctgacaatgatgcaggcccaacagaaggctttacaggct
ttaaggcctcaagttgatttagtaaaaaagcttgctcaagacctggtagtagaagcttct
gattcagcgggtgtttctgaccttttgcttcaagctgaatctttggagcaagaatatact
gcagtgaaccagcaggttgaagataggtgctcgttcttggaaacaaaacttcagggaatt
ggtcatttccaaaacagcatcagagagatgttctctcagtttgcagagtttgatgatgaa
cttgatagcatggctccagtggggagagatcttgatgtactgcaatcacagagagaggat
ataaaacatttcctgaaaaagttggaagatcttataatgaataatgaaaatgctaataaa
aactgtaaaatgatgctagccacagaagctgaagcttctcctgatcttgttggtataaaa
cgggacttggaagcattaaataaacaatgcaacaaactactagacagagcaaaagccagg
gaagatcaagtggaaggtacaattaaccgtgttgaggagttttacagtaagctaaaagaa
ttctccagtctgcttgggagagctgaagaacatgaagaatcgcaaggtcctgttggaatg
gaaacagaaactattaatcagcagctgaatacgttcaaggtattccagaaagaagaaatt
gagcccctgcaagttaaacaacaggaggtgaactggttgggtcaaggcctaattcaaagt
gctgctaaaagtaccaacacagaaagccttgaacatgaccttgaagatgttaacacccgg
tggaaaactcttaataagaaggttgctcaacgtgcagcacaattgcaggaagccctcctt
cactgcgggagatttcaggatgcacttgaatctctgcttagttggctcattgatacagaa
gaacttgtggctaatcaaaagccgccatctgccgaattcaaagttgtgaaagcccaaata
caagagcagaaacttctccagaggctgttagatgaccgcaagcctactgttgaggtaatc
aagcgtgaaggggagaaaattgcagagtcagcagaacctgctgataaagtgaaaatcttg
aagcagttgagtttgctggatagtcgatgggatgcattgctcagtaaagctgaaacaagg
aaccgtcagttggaaggcatctcagtggtagcacagcagtttcatgaagctctggagcca
ctggtggagtggctgtcggccacagagaagagacttgcaaatgctgaacccattggaaca
caggcttccaaactgcaacagcagatttctcagcataaagccctagaagatgatgtccta
gctcacaataagagtttgcttcaggccattagcattggtcagtctctaaagactatgagc
tccagggaagataaagatatggtgcaggaaaagctagattcttctcaggcccgatacatt
gagattcaagagaagagcaacagcaggtctgaacttctacagcaagcgtactgcaatgct
cagatttttggggaggacgaagttgagttgatgaactggctgaatgaagtccatgataaa
ctgagcaagttgtcagtccaagattgcaacacagaattgcttgagaaacagcactctgaa
ctactggagcttcaggaggagattcttctcagaaaacaaaatgtcgatttggctatacaa
aatggcttagagcttctcaaacaaacaacaggtgatgaagttataataattcaagataaa
ctggaaggcattaaagtgagatacaaagacattacaaaattgagttctgatgtgtccaag
accttagagcaagccctacagcttgcaggtcagctgcactcaacccatgaagagctctgc
aaatggcttgacaaagtggaagtggagttactgtcatatgaaactcaaatgccaaagggt
gaagaattaagccaagcacaagaaagacaaaaagagttgaagcaagaagcaaaaaacaac
aaagccttactggacactctcaatgaagttggcagtgccttcctggaactggtgccatgg
agagctagagagggacttgacaagatgataacagaggacaacgaacgatacagattagtg
aatgacacaatctctcagaaggtggatgagattgatgctgctatcctgagatcccagcag
ttcgatcaagcagctgatgctgaacttgcctggattgcagaagcagaaaagaaactgatg
tctcttggcgatattaggcttgagcaagaccagaccgcagctcagctacaagttcaaaag
gcttttaccatggagattttgaggcacaaagatactatagatgaacttgttaagtccggg
gataagattatgaacacgtgcactgaagaagagaagcagacgataaagaaaaaactgaaa
agcctgttacagaaatatgatacagtctgtcaaatgaactcagagagaaaccttcagctg
gagagggctcagtcccttgttaaccaattctgggagacttatgaagagctttggccatgg
ttaactgaaacagaaatgatcatctctcagcttcctgcaccggcccttgagtatgaaact
ttaaagcaacaacaagaagagcatcggcaactgcgtgagctgattgctgagcacaagcct
catatagataagatgaataaaactgggcctcagttgctggagctgagcccaggagaaggt
ttctctatccaagagaaatatgtggcagctgacaccctttacagtaaaattaaggaagat
gtcaaaaagagagcactggcactggatgaagccctttctcagtgtacccagtttcatgac
aagatagatccaactcttgagagtttgcaacgcatagttgaacgtctgaggcagccacct
tcaatctcagcagaggttgagaagattaaagagcaaattagtgaaaataagaatgtgtca
atggatctggaaaaacttcagccagtctatgagacgcttaagcagcgaggggaagaaatg
atcgctcgctcagaaggagcagataaggatgtatctgctaaagttgtgcaagataaacta
gaccaaatggtccttatttggcaagacatccagaccttgactgaggaaagggaggccaaa
ttgttggatgttatggaactagctgaaaagttctggtgtgatcatatggctctcgtagct
actattaaagatactcaggacttcattcgagaactggagggacctggagttgacccatct
gtagtcaagcaacagcaagaagctgctgaggctgctaaagaagaaattgatggactgcaa
gaagaactagagagcgttgtaagcctaggctctgaacttagagctgcctgtggagagcct
gacaaacctattgtcaacaagagtatagatgagctgaactctgcctgggatgccttaaac
aaaacatggaaagagcgagtggataagcttgccgaagctatgcaggcagctgttcaatac
caagatggactgcaggcaatatttgactgggtagacattgctggcatcaagctagcatct
atgtcccccgttggaacggatctggagacagtgaagcaacaaactgaggaacttaagcaa
tttaaaacagaagcttatcagcagcagatagaaatggaaagactgaaccatcaagcagaa
ctattgctgaagaaggtaacacaggaaagtgacaagcacactgttcaagaccctctctca
gagctcagaataatgtgggacagcctggaggaaaaaattataaatagacagcacaagctg
gaaggtgccttgttagccttggggcagttccagcatgccctggatgagttacttacgtgg
ctgacgcatacagaagacttgctgaatgaacagaaacccgtgggtggagaccccaaggct
attgaaattgaacttgccaaacatcatgtgctacagaatgatgttttagctcatcagtct
acagtagaagcagttaagaaagcaggaagtgacctgattgagtcaagtgctgttgaagaa
gcaagtaatttacggagcaagttggaacttctgaatcagcgctggcaaaatgtgttggaa
aaaacagaacaaagaaaacagcagctggacagtgccttgatccaggcccaaggtttccat
ggtgaagttgaagatatgcagcaatggctgacagacactgaacgtcaactgttggcatca
aaacctgttggaggcttaccagaaacagcaagagaacagcttaatacccatatggaactt
tgtgctgcctttgaagccaaagaagagacatataagtgtctaatgcagaaaggccagcag
atgcttgcaagatgcccagagtctgctgaaacaaatgttgagcaggacataaataactta
aaagaaaagtgggaatctgtacaaacgaagctcggtgaaagaaaaaccaaactggaagaa
gccctcaatttagcaatggagttccacaactcacttcaagatttcatcaattggctcacg
caggcggagcaaactctaactgcagcttctcggccaagtcttatcttggacactgtcttg
tttcaaattgatgaacataaggtttttgccacagaggtgaattctcatcgagatcagatc
atagagctggacaaaactggtacccatttgaaatacttcagccagaaacaagatgtagtc
cttattaagaatctgctgattagtgtacaaagtagatgggaaaaagtagttcagcgctta
gtcgaaaggggaagagctttggatgatgcaaggaaacgagccaaacagttccatgaagcc
tggcacaaacttatggagtggctggaagaatcagagaaatctttggactcagatcttgaa
attgcaaatgaccctgacaaaataaagatgcagcttgcgcagcataaggaattccagaaa
tctcttggtgccaaacattctgtgtacgataccacaaacaggactggacgctccttgaaa
gagaaaaccactttggctgatgacaatttgaagcttgatgatatgctgagtgaactaagg
gataaatgggacacaatttgtggaaaatcagtagaaagacaaaataaactggaggaagcc
ctgttattttcaggacaatttaccgatgctctacaagctctcattgattggttatacaaa
attgaacctcagctagcagaagatcagccagtgcatggagacattgatttagtgatgaac
ctgattgacaatcacaaggttttccagaaggagttgggaaaaagaacgagcagtgttcag
gctctgaagcgctctgccagagagcttatagagggcagtcgtgatgactcgtcatgggtc
aaagtccagatgcaggagctgagcactcgctgggaaacagtttgtgccctgtcagtatcc
aagcaaacacgacttgaacaggctctccgacaggcagaggaattccactctgttgttcat
gtccttttggagtggctggcagaggcagagcaggctcttcgtttccacggcgtccttcca
gatgatgaagaggccttgcgtacactgatagatcagcacagggagttcatgaagaaactg
gaagagaaaaaagcagaactgaataaagcaacaggtatgggagaagctatcctggctatc
tgccatccagactccatcaccaccattaagcattggataacaattatcagagcaaggttt
gaagaggtattagcttgggccaaacaacatcagcagagactggcaggagctctggctgga
cttattgctaaccaggaattgctggaagccttgctgtcctggttgcagtgggcagagact
acacttactgaaaaagataaagaggttatcccccaggagattgaggaagttaaagcactt
atagctgaacatcagacattcatggaggaaatgaccagaaaacaacctgatgttgataaa
gttacaaagacctataaaagaaaggcacttgaacctactcctgtacaatctcatattcct
gtccttgataaggggagagcaggaagaaagcgttcccccacaccaggcttatatccatca
gcagcccaggcgcaaattgaaaccaagaatccacgggtaaaccttttagtcagcaaatgg
cagcaagtctggcttctggccttggaaagaagaagaaaactcaatgatgctttggacaga
cttgaagagctgagagaatttgccaactttgattttgatatttggaggaaaaaatatatg
cgatggatgaaccataagaagtctcgcgtaatggacttcttcaggaggattgataaagat
caggatggaaaaataacaaggcaggaatttattgatggaattctttcttcaaaattccca
acaagcagacttgaaatgagtgctgttgcagacatttttgatagagatggtgatgggtat
attgattattatgagtttgtagcagctcttcatccaaacaaggatgcttacaagcctctc
acagatgctgacaaaattgaagacgaggttacaagacaagtagctaaatgtaaatgtgca
aaacggtttcaagtggaacagattggggataacaagtacaggttcttcctgggaaatcag
tttggtgactctcaacaactacgccttgttcgtatcctaagaagtacggtcatggttcgt
gttggaggtggctggatggcacttgatgagttcttagtgaaaaatgatccttgcagggct
aaagggaggacaaatgtagagctgcgtgagaagttcatcttggcagatggtgccagtcag
agcatggcagctttcagaccaagaggccgtagatcacgaccctcttcaaggggtgcttct
ccaaaccgatctacttctctgtcaagtcaggctggccaggcagctgccccacaagcagtt
gctacgagtacaccaaagacaccacatcatttaacacgcaactatggtaaaccatggttg
acaaacagcaaaacgtcaactccttctaagccaccagaatcctcagactatcaagggtca
tctggagagggaacacctattcaaggaagtaaactcagactgccaggatatctatcgggg
aagggtttccactctggagaagacagcggcatcttgtccacagcagctaccagagtcaga
gctcagtttgcagaaaccaggagaactccaagcagacctggaagccgagcagggagcaag
gctggcagcaggtcgagtagccgcagaggcagcgatgcatctgactttgatatttcagaa
atccagtctgtatgctcagatatgtcagagactgttccagctacaagcagaccgacgccc
cgagcaggttctcggccaggatcagccaagccttctaaaattccaactccccagagaagg
ccgatagccagcaaattggacaggtccttgaagagataa

DBGET integrated database retrieval system