KEGG   Gallus gallus (chicken): 421895
Entry
421895            CDS       T01006                                 

Gene name
FBXO9
Definition
(RefSeq) F-box only protein 9
  KO
K10295  F-box protein 9
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    421895 (FBXO9)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     421895 (FBXO9)
SSDB
Motif
Pfam: F-box-like F-box MIT
Other DBs
NCBI-GeneID: 421895
NCBI-ProteinID: NP_001006414
CGNC: 12207
Ensembl: ENSGALG00000016320
UniProt: Q5ZIN8
Position
3
AA seq 435 aa
MAEAEEDCHSDLVRTDDNERSGEANLQAELQMFRAQWMFELAPGVSSSGLESLPCRTSSR
GPGVKSVDTRGKQEIAKEEKAKELFLKAVEEEQNGALYEAIKFYRLAMQLVPDIEFKIAY
TRSPDGDGVGKRCIEDNEEDGKMADLLSDFQQQLTFQESSVKLCQPELDVNQTHISALPL
EVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWHQVCLKVWGRSCNKLVPYSS
WREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYLRFFPDGQVMMLTT
PEDPQSIVPRLRTKNTRMDAILLGHYRLSQETDNQTKVFAVIMKKKEEKPVDYHKYRYFR
RVPVQETEHSFHVGLQLCSSGRQTFNKLVWIHHSCHITYKSTGETAVTTFDIDKMYTPLF
FARVKSYTAFSEKPL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcagaagctgaagaagattgtcactctgatttggtaagaactgatgacaatgaaaga
tctggtgaagcaaaccttcaggcagaactgcagatgttcagagctcagtggatgtttgag
cttgccccaggtgtgagttctagtgggttggaatctctgccatgcagaacatcatcaaga
ggacctggagtaaagtctgtagataccagaggcaaacaggagatagcaaaagaggaaaag
gcgaaagaacttttcctgaaagcagtggaagaagagcaaaatggggccctttatgaagcc
atcaagttttatcgcctagccatgcagcttgtccctgacatcgagtttaagatcgcctat
acacggtccccagatggtgatggagttggaaagcggtgcattgaggacaatgaagaggat
ggcaaaatggctgatctcctgtcagatttccagcaacagttaacttttcaggaatcttct
gtcaaactttgtcagcctgagcttgatgtcaaccagacccatatctcagcattgcctctg
gaggtattaatgtacattttccgatgggtggtttcgagtgacttggacctgagatcatta
gagcaattatctcttgtttgtcgaggattttacatttgtgccagagatcctgaaatctgg
catcaagtctgtttgaaagtatggggcaggagctgcaataaacttgttccatattcttcc
tggagggaaatgtttttggaaaggcctcgtgttcgatttgatggtgtatatatcagcaag
acaacgtacatacgccaaggagaacaatctcttgatggtttctatagagcgtggcaccaa
gtggaatattacaggtatttgaggttctttccagatggtcaagttatgatgcttacaacg
cctgaagatccacaatctatcgttccacgcttacggactaaaaatacaagaatggatgca
atcttgcttggtcattatcgcctttcccaggaaacggacaatcaaaccaaagtatttgct
gtaataatgaagaaaaaagaagagaaaccagttgactaccacaagtataggtatttccgt
cgtgttccagtgcaagagacagaacatagttttcatgtaggacttcagttgtgctccagt
gggcgccagactttcaacaaacttgtttggatacatcattcttgtcacataacttacaaa
tcgactggtgagacagcagttactactttcgacattgacaaaatgtacacccctttgttc
tttgcacgagtgaagagttatactgcgttttcagaaaagccgctctga

DBGET integrated database retrieval system