KEGG   Gallus gallus (chicken): 421900
Entry
421900            CDS       T01006                                 

Gene name
ARHGEF10
Definition
(RefSeq) rho guanine nucleotide exchange factor 10 isoform X1
  KO
K16727  Rho guanine nucleotide exchange factor 10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    421900 (ARHGEF10)
   03036 Chromosome and associated proteins [BR:gga03036]
    421900 (ARHGEF10)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    421900 (ARHGEF10)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     421900 (ARHGEF10)
SSDB
Motif
Pfam: WD40_2 PH_19 RhoGEF
Other DBs
NCBI-GeneID: 421900
NCBI-ProteinID: XP_001235643
CGNC: 12233
Ensembl: ENSGALG00000016350
UniProt: F1NNU8
Position
3
AA seq 1352 aa
MDTEEFPPPPPEVLEHEPKAVSTNDEEEDEGELFDFDSGDEIPEADRQALVPPPPDPGNN
TEHQEANVTAKGADNLEKSEKLQASEPTAEDAPRKVNPYSVINISPMQEKDPSSSPDPSP
QDEPASPNVSSGYSVPVPCGYAVPSNLPLMLPAYSSPVIIRSVSVDEEAGMQSATEECHC
NSLNTEEPQNSEDNQVKREDDALAKWVADPANTEWMENPDEVIYDDVPRENSDSEPEEMI
YDDVENGDDGGNSSLEYGWSSSEFESYEEQSDSECKNGIPSSFLRGNHKRHLSHDLTRLK
EHYEKKMKDLMANTVGAVEIQQLKQKHELKMQKLMRAAREGTKDGLEKTKAAVKKGRSFI
RTKSFISQDHRSSCLEEEELNLFIDVDCVHTEAIMTPMPEGLSQQQVVRRYILGSVVDSE
KNYVDALKRILEQYEKPLSEMEPKLLSERKLKMVFYRIKEILQCHSMFQIALASRVSEWD
SVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVGILKKTCATKPAFLDFLKQCQESSPDR
ITLYGLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDAD
QRCEIKQIAKAMNERYLNKLLSSGNRYLIRTDDMVETVYNDKGEIIKTKERRLFMLNDVL
MCATVNVRTSYESSGTMTTGQRYLLKWSVPLGQVEVIEYGSSEGQGENCRFPPQHSAENV
IVNSKPNKLYMGPGQLYHDLQNLLHDLNVVGQISQLIGSLKGNYQNLNQSVAHDWTSGLQ
KLILKKEDEIRAADRCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKQSWINNLQMAKLA
LAEDNLLGWFCVEDDGNQIKKEKHPLLVRHMPVMMAKQQEFKIECAAYNPELYLSGETDS
DSCSMEHGFLWIGSCTNQMGQIAIVSFQSSGPKVIECFNVESRILCMVYIPEEEKIKEIN
MSLNSENVPTKASNVPTICLGMEEGSISIYKSCQGSKKIRLQHFFTPEKSTVMSLTYMSQ
YLFAGLVNGNIAIYTKAEDGTWNMEPQKTVKLGVLPVRSLLVMEDTIWAACGGQIFIIST
VTHFIESHFEAHQEEGMVISHMAVAGVGVWIAFTSGSTLRLFHTETLKHLQDINIATPVH
NMLPGQQRVSVTSLLVCHGLLLVGTNLGIIVALPVPRLQGIPKVTGRGMVSYHAHNGPVK
FLVMATSLNKKNKNKLRNSLPRGSESKDKDQRNVLHNDRPGSSNGSNPDTSVWLGGSAGS
IAQKSDLSSSSGSLTSSSLEHRPEDSNIYELLKDQNISFKNKRQRSKKMKASSVLVISGG
QGHRRVNKKTKQQRQDELVSSVMVWQIPLLNI
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggacacagaggaattccctcccccacccccagaagttctagagcatgaacccaaagct
gtgagtacaaatgatgaagaggaggatgagggtgaactgtttgactttgacagtggggat
gagataccggaagcagacagacaagcccttgtgccacctcctcctgatcctggaaataac
acagagcaccaagaggctaatgtcacagctaaaggagctgataacttagaaaaaagtgag
aagctacaagcatcagaacctactgcggaagatgctccaaggaaagtgaatccctactca
gtcataaatatttccccaatgcaagaaaaggatccatcctcctcaccagatccaagtcct
caagatgaacctgccagtccaaatgtgtccagtggatattctgtccctgtgccctgtggt
tatgcggtgccatccaatttacctctgatgctgccagcatactccagtcctgtcataata
cgtagtgtttctgtagatgaggaagcaggtatgcagtcagcaactgaagaatgtcactgt
aattctttaaacacagaggagccccaaaatagtgaagataaccaggtcaagagagaggat
gatgctctggccaagtgggttgcagatcctgcaaatacagaatggatggaaaacccagat
gaagtaatttatgatgacgtgccaagagaaaattcagactctgaaccagaggaaatgatt
tatgatgatgttgaaaatggtgatgatggtggaaacagctcactggagtatggatggagt
tcaagtgagtttgaaagctacgaagaacaaagtgattccgagtgtaaaaatggaattccc
agctcctttttgcgaggcaaccacaagagacacctttctcatgaccttacgcgtttaaag
gagcattatgaaaaaaagatgaaagatttgatggcaaacactgtgggagcagtagagatt
cagcaactaaagcaaaaacatgagctgaagatgcaaaagctcatgagagctgctagagaa
ggtaccaaagatggactagaaaagacaaaagcagctgtgaagaagggtcgttctttcatt
agaactaagtcttttatttctcaagatcatagatcatcatgcctggaagaagaggagcta
aatttatttattgacgtggactgcgtgcatacagaagcaattatgacccctatgcctgaa
ggattatcacaacagcaggttgtgagaagatatattttgggctctgtagttgatagtgaa
aagaattatgtagatgctctgaaaagaatcttggagcaatatgagaagcccctttcagaa
atggaaccaaaattactgagtgaaagaaaactcaaaatggtcttctatagaattaaagaa
attcttcagtgccattcaatgtttcaaatagcactggccagtcgtgtgtctgagtgggat
tctgttgaaatgattggtgatgtctttgttgcttcattttcgaagtcgatggtattggat
gcatacagtgaatatgtaaacaacttcagtacagcagtggggattcttaagaaaacatgt
gccaccaaacctgcctttctagatttcttaaagcagtgccaggagtcgagccctgatcgg
attacgctgtatggtttaatgatgaaacctatccagcgcttcccacagttcattctgcta
ttgcaggatatgttgaagaacacaagtaaaggacatcctgacagactgcccctgcagatg
gctcttacagaacttgaaacactagcagagaagctgaatgaaagaaaaagggatgcagat
cagcgctgtgaaataaaacaaatagcaaaagcaatgaacgaacgttacctgaacaagcta
ctcagcagtggaaacaggtacctcatacggactgatgatatggttgaaacagtttacaat
gacaaaggcgaaattatcaaaaccaaagagcgacgacttttcatgttgaacgacgtgctg
atgtgtgcaacagtaaacgtgcgcacttcctatgaaagcagtggcactatgacaactggc
cagaggtatttattaaaatggagtgtaccactgggacaagtagaagtcatagagtatggg
agcagtgaaggccaaggagagaactgcaggtttccaccccagcactctgctgaaaatgtt
attgttaactctaagccaaacaagctgtatatgggaccagggcaactataccatgatctg
cagaaccttttacatgatttgaatgtagttggtcaaattagtcaattaataggcagcctt
aaaggaaattatcagaacttaaaccaatcggtagcacatgactggacctcaggtttacaa
aaattgatcttgaaaaaagaagatgaaatcagagcagcagatcgctgtagaattcagctg
cagcttccaggaaaacaggacaagtctgggcggcctactttctttacagctgtattcaat
acatttacccctgcgatcaaacagtcttggatcaacaatttgcaaatggctaaactagcc
cttgcggaggataacctgttaggttggttctgtgtagaagatgatgggaatcaaatcaaa
aaggagaaacatcctctccttgttagacacatgccagtgatgatggccaaacagcaggag
tttaagattgaatgtgccgcttataatcctgaactgtacctctctggagaaacggattcg
gattcctgttccatggaacatggttttctttggattggcagttgtactaatcagatgggc
cagattgcaatagtctcatttcaaagctctggccctaaggttattgagtgcttcaatgtg
gaatcacggattctctgcatggtctacataccagaagaagagaaaataaaagagataaat
atgtctctcaactctgaaaatgttcctacaaaagcttctaatgtgcctactatttgcctt
ggcatggaagaaggaagcatttctatttacaaaagttgccagggctcaaagaaaattcga
cttcaacacttcttcactcctgaaaaatcaactgtcatgagcttgacgtatatgtcacaa
tacttgtttgctggcttggtaaatggaaacattgcaatctacacaaaagcagaagatgga
acgtggaacatggaacctcagaagacagttaaactgggggttctgcctgttagaagtctg
cttgtgatggaagataccatttgggctgcgtgtggtggacaaatttttataatcagcaca
gtgactcattttatagagagccattttgaagctcatcaagaggaaggtatggtaatctct
cacatggctgttgctggagtgggagtctggattgccttcacatctggatctacacttcgc
ctgttccacactgagacactgaaacacctccaggatattaacattgccacgcctgttcac
aatatgttgccagggcaacagcgtgtttctgtgaccagtctgctggtgtgccatggctta
ttactggttggaacaaatctggggataatagtagcattgccagtgccacgtttgcaggga
attcccaaagtaactggaagaggaatggtgtcgtatcacgcacacaatgggccagtcaag
tttcttgtaatggctacatctctaaacaagaaaaacaaaaacaagctaaggaacagcctg
cctcgtggctcagaatctaaagacaaagaccagaggaatgttctgcacaatgacagacca
ggctcttccaatggcagcaaccctgatacttcagtttggctgggaggttcagcaggatcc
attgcacaaaaaagtgacttgtcttcatcttctggatcccttacatcaagttccctagaa
cacaggccagaggacagtaacatttatgagcttttgaaggatcaaaatatctcttttaaa
aataaaagacagagatctaagaaaatgaaagcaagttcagtattagtcatttctggtggc
caaggacacagaagagtgaacaagaagaccaagcagcaacgacaagatgaattagtgtct
tcagtgatggtctggcaaatcccgctattaaatatatga

DBGET integrated database retrieval system