KEGG   Gallus gallus (chicken): 421934
Entry
421934            CDS       T01006                                 

Gene name
KLF11
Definition
(RefSeq) Krueppel-like factor 11
  KO
K09209  krueppel-like factor 10/11
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421934 (KLF11)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    421934 (KLF11)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 DUF5810 zf_Hakai zf-Di19 Hydrophobin_2
Other DBs
NCBI-GeneID: 421934
NCBI-ProteinID: NP_001006417
CGNC: 51568
Ensembl: ENSGALG00000016440
UniProt: Q5ZJT5
Position
3
AA seq 530 aa
MHGSGSPCPEMGDAAAVDIVDIYESIRERQRHDSERSTCSTLEQNDIEAVEALVCMSSWG
QRLQKGDILKIRPLTPFSDSGDFTMHAEAASELPKDCLSTLCMTPPHSPDLVEMSAAVLL
PSQVTYSKPRTVMANTAACLLTSTTDATPAAKPSVLSVERQCEQRADASAPQPCRAMATS
VIRHTGDSSAYHHGAAVREKAKAASGCGTSGDRRGAEGRRRPGLPQDACAADAFISKASP
VPQPCAADCSDVVHSKGQLPVRPVSPQAHLPKSCEDDLQRRATPVTPVPVSSPQVLCQMI
PLNGQSGVINAYVKPSAPAVSAPMKPILPQAAPLSQPVLVGSSVPQGAVMLVLPQTAVAP
TPQCPQTVMTVGNTKLLPLAPAPMFIASGQSCTPQMDFSRRRNYVCNFPGCKKTYFKSSH
LKAHLRTHTGEKPFSCNWEGCDKKFARSDELSRHRRTHTGEKKFACPVCERRFMRSDHLT
KHTRRHMATKKVPSWQTEVGKLNRMATAEKPKGSGALSMLIPVPSPVCQG
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcacggctcgggttcgccctgcccggagatgggagatgcggccgcggttgacattgtg
gatatctacgagtccatccgggagcggcagcgccacgacagcgagcgctcgacctgcagc
accctggagcagaacgacatcgaggccgtggaggcgcttgtttgtatgagctcctggggg
caaagactgcagaaaggtgacatattaaagataaggcctctcacgcccttctcggattct
ggagatttcacaatgcacgctgaggccgcttctgaattaccgaaggattgtttatccaca
ctgtgcatgacccctccgcacagccccgacttggtggagatgtctgccgccgtgctgctc
ccctcgcaggtcacctactccaagcccaggaccgtcatggcaaacacagctgcctgcttg
ctcacgtccaccaccgacgcgactcccgcggccaagccgtccgttctgagcgtggagagg
cagtgtgagcagagggcggacgcctctgcccctcagccctgccgggccatggcgacgagc
gtcatacggcacacgggcgacagctctgcttaccaccacggtgctgccgtgcgagagaaa
gcaaaggcagcttcgggctgcggcacttctggggaccggcgtggagcagagggccgaagg
cgtcccggcctgccgcaggacgcgtgtgctgccgatgctttcattagcaaagcctctccg
gtaccccagccgtgcgctgctgactgcagcgatgtggtgcatagcaagggacagcttcca
gtccgacctgtttcgccacaggcccacttaccaaagagctgcgaggatgacttgcaaaga
agagctaccccggtgacgcccgtccctgtgtcaagcccccaggttctctgtcaaatgatc
cccttgaatggacaaagcggtgtgattaatgcctacgtcaaaccttcagctccggccgtc
tcagctccgatgaaacctatcttaccgcaggcggctccgctttctcagcctgtgctcgtg
gggtcttctgtgcctcagggggccgtcatgttggttcttccgcagaccgctgtggcaccg
acgccgcagtgcccgcagacagtaatgactgttgggaacaccaagctcctgcccctcgct
cctgcccccatgttcatcgcttctggtcaaagctgcaccccccagatggacttctcgaga
cggaggaattacgtttgcaacttccccgggtgcaagaaaacctatttcaagagctcccac
ctcaaagcccaccttcgtacccacactggagaaaagcccttcagctgcaactgggaaggc
tgtgacaagaagtttgcccgctcagacgaactgtcacgccaccgccgaactcacacgggg
gagaagaagtttgcctgccccgtgtgcgagcgccgcttcatgcgcagcgatcacttgacg
aagcacacccgccgccacatggccaccaagaaggtccccagctggcagacagaggtgggc
aaactgaacagaatggccacagcggagaagccgaaaggcagcggtgctctgagcatgctc
atccccgtgccatcgcccgtctgtcagggctag

DBGET integrated database retrieval system