KEGG   Gallus gallus (chicken): 421940
Entry
421940            CDS       T01006                                 

Gene name
PDIA6
Definition
(RefSeq) protein disulfide-isomerase A6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    421940 (PDIA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    421940 (PDIA6)
   04131 Membrane trafficking [BR:gga04131]
    421940 (PDIA6)
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     421940 (PDIA6)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   421940 (PDIA6)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    421940 (PDIA6)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_6 OST3_OST6 Thioredoxin_8 Thioredoxin_3 Thioredoxin_9
Other DBs
NCBI-GeneID: 421940
NCBI-ProteinID: XP_419952
CGNC: 12314
Ensembl: ENSGALG00000016447
UniProt: F1NK96
Position
3
AA seq 447 aa
MGVRGTGGLWWGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWC
GHCQRLTPEWKKAATALKGVVKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQ
GGRTSEAIVDAALSALRSLVKDRLSGRSGGYSSGRQSRESGGGDKKDVIELTDDSFDKNV
INSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQMLANRYGI
RGFPTIKIFQKGEDPVDYDGGRTRSDITARALDLFSDNAPPPELLEIINEDVLKTTCDAH
QLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGF
GYPAMAAINARKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVGGGAFPKIHAVEPWDG
KDGELPVEDDIDLSDVDLDDIWDKDEL
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggggtgcgcggaacgggcggcctgtggtggggcacagtgagctgcacgttattcctg
gcagttaacggtttatattcggccagtgatgatgtgatagagctaacaccaaccaacttc
aacaaggaggtcattcagagtgagagcctgtggctcgtggagttctacgccccatggtgt
ggtcattgtcaaagactaacccctgagtggaagaaagctgcaacagcattaaaaggtgta
gtgaaagtaggtgcagtagatgcagataagcatcagtctttgggtggacagtatggagtc
agaggttttccaactatcaagatatttggagccaacaaaaacaaagctgaagattatcag
ggtggcaggacaagcgaagccattgtcgatgctgctctaagtgctcttcggtccctggtg
aaagaccgtctcagtggcagaagtggaggatacagttctgggagacagagccgagagagc
ggaggcggagataagaaggacgtgattgaactgactgatgacagcttcgataagaatgtc
ataaatagtgatgatgtgtggatggtggagttttatgccccatggtgtgggcactgcaaa
aatctggagccagaatgggcagctgctgccactgaggtgaaggaacaaaccaagggaaaa
gtcaagctggctgcagtagatgcaacagtcaatcagatgctggcaaaccgatacgggatt
cgtggatttcccacaattaaaatattccagaaaggagaagaccctgttgattatgatgga
gggagaactagatctgatatcactgctcgtgctctggatctgttttctgataacgcacca
ccacctgagctcctggagataattaatgaagatgttctgaagactacctgtgatgctcat
cagctctgcatcatttctgtcctgcctcatattcttgacacaggagcctcggggaggaat
tcttacctggatgtcatgctaaaaatggctgagaaatacaaaaagaaaatgtgggggtgg
ctgtggaccgaagctggtgctcagtcagatcttgagagctctttgggaataggaggcttt
gggtatccagcaatggcagccattaatgcccggaagatgaaatttgccctcctgaaggga
tcattcagtgagcaagggattaatgagtttctcagggaactgtctgttggtcgtggttct
acagcaccagtaggaggtggagctttccctaaaattcatgcagttgaaccttgggatggc
aaagatggtgagcttccggttgaagatgatattgatctcagcgatgtggacctggatgat
atctgggataaagacgagctgtga

DBGET integrated database retrieval system