KEGG   Gallus gallus (chicken): 421943
Entry
421943            CDS       T01006                                 

Gene name
E2F6
Definition
(RefSeq) transcription factor E2F6
  KO
K09390  transcription factor E2F6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421943 (E2F6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    421943 (E2F6)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TrmB DUF1664
Other DBs
NCBI-GeneID: 421943
NCBI-ProteinID: NP_001231667
CGNC: 51570
Ensembl: ENSGALG00000016454
UniProt: E1C979
Position
3
AA seq 252 aa
MAAASKWERLRPLRPDTLRLSATPMLDLNLDDDVPVVKKTLKVKRPRFDASLVYLTRKFM
DLVKRAPDGVLDLNDVATALGVQKRRVYDITSVLDGIDLIQKRSKNHIQWVGSNLDQVVE
MAAQRQNLKDELSDLSAMEEALDELIKDCAHQLFDLTDDKENAKLAYVTYQDIRSIQAFQ
KQIVIAIKAPEETRLEIPIPKEDCIKVHVKSTKGPIDVYLCEVEQDKPADKNSEDKEAVT
SETEPSVPPDEE
NT seq 759 nt   +upstreamnt  +downstreamnt
atggccgccgcctccaagtgggagcgcctgaggccgctacggccggacacgctgcgtctg
agcgcgacaccaatgcttgacttgaatttggatgatgacgtaccagttgtaaaaaaaact
ctgaaggtcaaaaggcctcgatttgatgcatccttggtttatttgactcgaaaattcatg
gatcttgttaaaagagctccagatggtgtccttgatttaaacgacgtagcaacagctctt
ggagtacaaaaacgaagagtatatgacatcaccagtgtgttggatgggatcgacttaatt
cagaaaagatcaaagaatcacatccagtgggtaggttctaatcttgaccaagttgttgaa
atggcagcacagcggcaaaaccttaaagatgaactttctgacttgtcagccatggaagaa
gctctggatgaattaatcaaggattgtgctcatcagttatttgatctaacagatgacaaa
gaaaatgcaaaactagcttatgtgacgtaccaagatatccgtagcattcaggcatttcaa
aaacagattgtgattgcaatcaaagctccagaagaaaccagactggaaataccgattcct
aaagaggattgcatcaaagtacatgtaaagagcacaaaaggacccattgacgtgtatctg
tgtgaggtggaacaagataagccagcagacaaaaattctgaagataaggaagctgtcact
tctgaaactgagccatcagttcctcctgatgaagagtga

DBGET integrated database retrieval system