KEGG   Gallus gallus (chicken): 421959
Entry
421959            CDS       T01006                                 

Gene name
LAPTM4A
Definition
(RefSeq) lysosomal-associated transmembrane protein 4A
  KO
K12387  lysosomal-associated transmembrane protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    421959 (LAPTM4A)
SSDB
Motif
Pfam: Mtp DUF4728
Other DBs
NCBI-GeneID: 421959
NCBI-ProteinID: NP_001026263
CGNC: 12339
Ensembl: ENSGALG00000016479
UniProt: Q5ZML7
Position
3
AA seq 229 aa
MTFKRSRDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMGILLTVEVTHPNVVPTVNIQY
EVIGNYYASERMAENACVLFAISLLMFTISAMMVYGAIAHRVGWLIPFFCYQLFDFVVSC
LVAISSLTYLPRIKDYLDQLPDFPYKDDLLSLDSSCLLFIVLVFFALFIILKAYLINCVW
NCYKYISNRNLPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPSPSYIPA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacgttcaagcgaagccgcgaccgtttttacagtactcgctgttgtggttgctgccat
gtgcggaccggcaccataattttagggacctggtacatggtggtgaacttgctgatgggc
atcttgttgactgtagaagtgactcatccaaacgtagtgccaactgttaatatccagtat
gaagtcattggaaattactatgcttctgagagaatggctgaaaatgcctgtgttctattt
gccatctccctcctcatgttcacaatcagtgcaatgatggtgtacggtgcaattgctcac
cgtgtaggttggctgatcccatttttctgttaccaactctttgactttgtggtcagttgt
ctggttgcaatcagttctctaacctacttgccaaggatcaaggattacttggatcagttg
ccggatttcccttataaagatgatcttctttcactggattccagctgtcttctgttcatt
gttctggtgttctttgctttatttatcattttaaaggcgtacctaatcaactgtgtatgg
aactgctacaaatacatcagcaacagaaatttgccagagatagcagtgtaccctgctttt
gaagcacctccacagtacgttctgccaacttatgagatggcagtgaagatgcctgaaaag
gagccttcaccttcctacatacctgcctga

DBGET integrated database retrieval system