KEGG   Gallus gallus (chicken): 422003Help
Entry
422003            CDS       T01006                                 

Gene name
PBK
Definition
(RefSeq) lymphokine-activated killer T-cell-originated protein kinase
  KO
K08865  PDZ-binding kinase [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     422003 (PBK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  TOPK family
   422003 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1
Motif
Other DBs
NCBI-GeneID: 422003
NCBI-ProteinID: NP_001264928
CGNC: 12423
Ensembl: ENSGALG00000016582
UniProt: F1NGQ3
Position
3
AA seq 322 aa AA seqDB search
METSKSQSSLDQKEKPGPASITIPASPSMQKLGYGTGVNVYLMKRSPRGLSRSPWAVKKI
NSKCSKNQQNIYQSRLNEEAKILKSLKHPNIVGYRAFTEANDGSMCLVMEFGGEKSLNDL
IEERNAARLGPFPAATISKVALSMARGLKYLHNDKKLLHGDIKSPNVVVKGDFEAIKICD
VGVSLPLDENLTVSDPTVHYIGTEPWKPKEALSDDGVITDKADIFSFGLTLWEMMTLSVP
HLNLGSSTDDEDESFDEDDFDEEAYYAALGTRPALNMDELDSSYQQVIELFSICTSEDPK
KRPSAAHVVAVLEASLPPELRA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccagcaaatctcagagcagcctggaccagaaggagaaacccgggccagcttct
atcactattcctgcctccccctccatgcagaagcttggatacggcactggggtgaatgtc
tacttgatgaaaagatctcccagaggtttatctcggtccccatgggctgtgaagaaaatt
aattccaaatgcagtaagaatcagcaaaacatctatcagtccagactgaacgaagaggcc
aagatcttgaaaagcctcaagcaccccaacattgtgggttaccgtgcattcactgaggcc
aacgatggaagcatgtgtcttgttatggagtttggaggagaaaaatctctcaatgactta
attgaagaaagaaatgcagcacgtttgggccctttccctgctgcgacaatttccaaagtt
gccctgagcatggcaagggggctgaagtaccttcacaatgacaagaagctgctccatgga
gatatcaagtctcccaacgttgttgttaagggtgactttgaagccatcaagatctgtgac
gtgggagtatccctgcccctggatgagaacttgaccgtgagtgatcccacagtgcactac
atcggcactgagccctggaagcccaaggaagctctgagcgacgacggtgtgatcactgac
aaggctgacatcttctctttcgggctgactctctgggagatgatgaccctgtctgtgccc
cacctcaacctgggcagcagcactgatgatgaagatgagtcttttgatgaggatgacttc
gatgaggaagcatattatgcagctttgggaacccgtccagccctgaacatggatgagctg
gactcatcctaccagcaggtgatcgagctcttctctatctgcaccagtgaggacccaaag
aagcgtccctcagctgctcatgtggtggcagtcctggaggcaagcctgcccccagagctc
agggcctga

DBGET integrated database retrieval system