KEGG   Gallus gallus (chicken): 422055
Entry
422055            CDS       T01006                                 

Gene name
ENPP4
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase family member 4 precursor
  KO
K18424  ectonucleotide pyrophosphatase/phosphodiesterase family member 4 [EC:3.6.1.29]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    422055 (ENPP4)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     422055 (ENPP4)
SSDB
Motif
Pfam: Phosphodiest Sulfatase Metalloenzyme DUF1501
Other DBs
NCBI-GeneID: 422055
NCBI-ProteinID: NP_001006422
CGNC: 12524
Ensembl: ENSGALG00000016708
UniProt: F1N9T9
Position
3
AA seq 453 aa
MNLQIVLFVSAILSCCARSGSSAPRLLLVSFDGFRADYLETYSLPHLQELIEDGVLVKQV
TNAFITKTFPNHYSIVTGLYEESHGIVANDMYDPDAKKKFSQFNDSDPFWWNEAVPIWVT
NQQQRNGTSAAAMWPGTDVRINNTTPQFFMKYNFSVTFEERVEKIIRWLNSSDPVVNFAT
LYWEEPDASGHKYGPDDTENMRRVLEQVDQHVGFLTGKLKASGLWDTINVIITSDHGMAQ
CSPKKLIVLDNCIGRGNYTLIDRSPVAAVLPKNNKEYVYNLLKQCDDRHMKVYLKEEIPD
RFHYRHNKRIQPIILIADEGWTIVQNEALSKLGDHGYDNTLPSMHPFLAAHGPAFRRGYQ
QSMINNVDIYPMMCHILGLTPQPHNGTLSHTKCLLADQWCIHLPEAIGIVIGGLLVLTTF
TCIVIIITKSRVASPRPFSRLQLQSDDDDPLIE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaacttgcagatagtgctgtttgtgtctgccatcctcagctgctgcgctcgctcgggc
agctcagcccccaggctgctcttggtgtcctttgatggcttcagggctgattacttggaa
acctatagccttcctcaccttcaggagctcattgaggatggtgtgcttgtaaagcaagtt
acaaacgctttcatcaccaagactttcccaaaccattacagcatagtgacgggtttatat
gaggaaagccatggcatcgtggctaacgacatgtatgatccagatgccaagaaaaagttc
tcgcagttcaatgattcagatcccttctggtggaacgaagcggtcccgatttgggtgaca
aatcaacagcagagaaatgggacgagtgctgctgccatgtggcccggtactgatgtgagg
attaacaacacgacccctcagttcttcatgaagtataatttttcggtgacgtttgaggag
agagtggagaaaatcattaggtggctgaacagctctgatcctgtcgtcaattttgctacg
ctgtactgggaagaaccagatgcgagcgggcacaagtatgggccagatgacactgagaac
atgcgccgagtgttagagcaagtggatcaacacgttggtttccttactggtaaactgaag
gcgtcaggtttgtgggacactattaatgtcataataacaagtgatcacgggatggcccag
tgctctccaaagaagctgatcgtcctggacaactgtatcggtcgtggtaactatactcta
attgacaggagtccagttgctgcagtgctgccaaagaacaataaagaatatgtgtacaac
ttactgaaacagtgtgatgatcgtcacatgaaagtatatctcaaagaagaaatcccagac
aggtttcattatcgccataataagagaattcagcccataattctgattgcagatgaaggt
tggacaattgtacagaatgaggccctctcaaagctaggtgaccatggttatgacaacact
ctcccaagcatgcatccattcctggctgctcatgggcctgcttttcgtcggggctaccag
cagagcatgataaacaacgtcgatatttacccaatgatgtgccacatcctgggactgaca
ccgcagccacacaacggcactctcagccacaccaagtgcctgctggctgaccagtggtgc
atacacctcccagaggctattgggatagtgattgggggactgctggtattgactaccttc
acctgcattgtaataatcatcacaaagagcagagtagcttctccacgtccgttttcccgg
cttcagttacaatctgacgatgatgaccctttaattgaatag

DBGET integrated database retrieval system