KEGG   Gallus gallus (chicken): 422093Help
Entry
422093            CDS       T01006                                 

Gene name
PCYT2
Definition
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00440  Phosphonate and phosphinate metabolism
gga00564  Glycerophospholipid metabolism
gga01100  Metabolic pathways
Module
gga_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    422093 (PCYT2)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    422093 (PCYT2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     422093 (PCYT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like FAD_syn CHAP
Motif
Other DBs
NCBI-GeneID: 422093
NCBI-ProteinID: NP_001278895
CGNC: 5480
Ensembl: ENSGALG00000007251
Position
18
AA seq 350 aa AA seqDB search
MVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEIAPG
APYVTTLETLDKYNCDFCVHGDDITLTIDGKDTYEEVKTAGRYRECKRTQGVSTTDLVGR
MLLMTKAHHSNIDEDLDYRKHTDNFGKGPKGHSPWTGVSQFLQTSQKIIQFASGKEPQPG
DTIIYVAGAFDLFHIGHVDFLEKVHQLAERPYIIAGLHFDQEVNRYKGKNYPIMNIHERT
LSVLACRYVSEVVIGAPYAVTADLLDHFKVTLVCHGMTEVVPDKDGSDPYEEPKRRGIFQ
LVDSGSNLTTDLIVQRIIKNRLEFEARNQKKEAKELAVLEAMKRLEEEKH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtgcactacggccactccaaccagctgcgccaggcgcgggccatgggcgattatctg
atcgtgggagtgcacacggacgaggagatcgccaagcataagggcccccccgtcttcacg
caggaggagaggtacaagatggtgcaagccatcaagtgggtggatgagattgcgcccggg
gctccttatgtcaccacgctggaaaccttggacaaatataactgcgacttctgcgtgcac
ggcgatgacatcaccttaacgatagacggcaaggacacctacgaggaagtgaagacagcc
gggcgatacagggaatgcaaacgcactcaaggtgtgtccactaccgacctcgttggccgc
atgctgctcatgactaaggctcaccacagcaacatagatgaggacctagactatcggaag
cacactgacaactttgggaagggaccaaagggtcatagtccttggaccggtgtctcgcag
ttcctgcagacatctcagaagatcatccagtttgcatcagggaaggaaccacagccagga
gatactatcatctacgtggccggagcctttgacctgttccatattgggcatgtagatttc
ctggagaaggttcaccagctggcagagagaccctacatcattgctgggctgcactttgac
caggaagtaaatcgttacaaagggaagaactatcccatcatgaacatccacgagagaacg
ctcagtgtcttggcttgcaggtatgtctcagaagtggtgattggagccccctatgctgtc
actgctgatctgctggatcacttcaaggtaactcttgtgtgtcatgggatgactgaggtg
gttccagacaaggatggttctgatccgtatgaggaaccaaagagacgtggcattttccag
ctcgtggacagcggcagcaacctcaccacagatttaattgtgcaaagaatcatcaagaac
aggctggagtttgaagccaggaaccagaagaaggaagccaaagagctggcagtattggag
gccatgaagagactggaggaagagaagcattag

DBGET integrated database retrieval system