KEGG   Gallus gallus (chicken): 422209
Entry
422209            CDS       T01006                                 

Gene name
ZMYM3
Definition
(RefSeq) zinc finger MYM-type protein 3 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-FCS DUF3504 YHS Arc_trans_TRASH
Other DBs
NCBI-GeneID: 422209
NCBI-ProteinID: XP_015133888
CGNC: 4122
Ensembl: ENSGALG00000005533
UniProt: A0A1D5NW74
Position
4
AA seq 1433 aa
MDSSEVSGSLDPLPLPDKPLIGDLPADMEFGEDLLGSQTASTQEASVLRPPDWDQSKQMT
ADGDLGLQEKGDGLSEQSKSNDLNLDKPSTALDVLEKPDVLDDLDGTAGSVELNKSEGLD
ELCKAQPSQDGEGGMGDSSTVSKEALVPETQKEGEGAPKTNSGDLKEDGAAAIPALSDDN
GPESPLQPAPDSGDLSSAPATEETTAQPSSPPIAPPQLSLKQSKKTRLKAPRKSSPVQRE
GLPGDAEVELSPDSRMAALPSEPAQEKKAEEWNADGNNSLRESTGLKAEEAALPAEGLSR
KGGVPQTEKEKRSERARRSETARPETVNSAESIPVSDEDSDAMVDDPNDEDFVPFRTRRS
TRMSLRTQIAQRAARSSAAKMTCANCRTPLQKGQTAYQRKGLPQLFCSSSCLTTFSKRPH
GKKMCTFCKKEIWNTRDSVVAQIGSGGSFHEFCTSVCLSLYEAQQQRPAPQFADPSDTIR
CSVCHKPGEVQHEVSNGNVVHRICSDACFTKFRATKGLKTNCCDYCGLYIYNKGMPVEYL
FHEGQQKRFCNSSCLNSYKKKNTRVYPCMWCKTLCKNFDMLPNVDRSGKMGLFCSICCTT
SHKVKQSGLVGPPRPCSFCRKSLSEPCYYNKTDRVVYQFCSPSCWTKFQHTSPEGGIHLN
CHYCHNLFTGKPEILDWQDKMYQFCCKDCCEDFKRLRGVVSQCEHCKQEKLLHEKIRFSG
VEKNFCSEGCVLLYKQDFTKNLGLCCITCTYCSQTCQRAVTEQLEGSTWDFCSEDCKSKY
LLWYFKAARCHACKRQGKLLETIHWRGQIKHFCNQQCLLRFYNQQNQPNLDTQKGPESLL
NSQSSETKPPAPSHQKAETNTLSSKTSSAHMSPAAPPPPPPPVPATPRKNKAAMCKPLMQ
NRGVSCKVEMKSKGCQTEADWKPQVIVLPIPVPIFVPVPMHMYCQKVPVPFSMPVPVPVP
MFLPTTLESADKIVETIEELKVKIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVSNQ
SAEGLLEDCDLFGPARDDVLAMAVKMANVLDEPGQDLEADFPKNPLYINPSVDFLFDCGL
VGPEDVSTEQELPRAVRKGQKRLVLSESCSRDSMSSQPSCTALNYSYGVNAWKSWVQAKY
AGGETSKGEELRFGPKPIRIKEDILACTAAELNYGLAQFVKEITRPNGERYEPDSIYYLC
LGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSGWQPTVLPNNTVFSRVEEEHLWECKQ
LGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTARGVTKMVSIRYCA
PAKQKKGRDGSTGKRKREEEMPMLEQRENKMNPLRCPVKFYEFYLSKCPESMRNRSDIFY
LQPERSCIAESPLWYSVIPMDRSMLESMLNRILVVREIYEEHSRLSSLEDDMD
NT seq 4302 nt   +upstreamnt  +downstreamnt
atggattctagtgaagtttcgggatctctggaccccctgcctctgcctgacaaaccactt
attggtgatcttcctgctgacatggagtttggggaggatctcctgggctcccaaacggct
tctacccaggaagcttcggttcttcggcccccagactgggatcagtccaagcaaatgact
gcagatggggacttgggccttcaggagaagggagacggcctgtctgaacaaagcaaatca
aatgacctcaatctagataaacccagtactgccttggatgtcctggagaaacctgatgtc
ttagatgacttggatggaactgctggctcggtggagctaaataaatcagagggtctggac
gagctgtgtaaggcacagccttcccaggatggggagggtgggatgggggactcctccacc
gtctctaaagaagccctcgttccagaaacacagaaagaaggggaaggtgcaccaaaaact
aactctggggacctaaaagaagatggtgctgctgctattcctgcactgtctgatgacaac
ggccccgaatcaccgctacagcctgctcctgactctggagacctcagcagtgccccagcc
acagaggaaaccacagcacaaccctcgagtccgccaatagcccctccacaactcagcctt
aaacagtcaaaaaagacgaggttgaaggcaccgaggaaaagctcacctgtgcagagggaa
ggactgccgggggatgcagaggtggagctgagcccagacagcaggatggcagctctgccc
tctgagcccgcacaggaaaagaaagcagaggaatggaatgctgatgggaacaactcactg
agagaaagcactgggctgaaggcagaggaagctgcattaccagcagaaggcctgtctcgg
aagggaggtgtgccccaaactgagaaggagaaaagaagtgaacgggccagaagatcagaa
actgccaggcctgaaactgtgaactctgctgagagcattccggtctctgacgaagactct
gatgcaatggtggatgatcccaacgatgaggactttgttcctttccgtacccgccgctcc
actcgcatgtcgttgcgcactcagatagctcagcgagccgcccgctcctctgctgccaag
atgacgtgtgccaactgccggaccccgctgcagaagggccagactgcctaccaacggaag
ggactccctcagctcttctgctccagctcctgtctcaccaccttctcgaaaagaccgcat
ggcaagaagatgtgcaccttctgtaaaaaggagatctggaataccagggactccgtggtt
gcccagataggttcaggtggctctttccacgagttctgcacctccgtctgcctctccctc
tatgaggcccagcaacagagaccagcacctcagtttgcagacccctcagacaccatccgt
tgcagtgtctgccataagcctggtgaggtccagcatgaggtcagcaatgggaatgtagtt
caccgcatttgcagtgacgcctgcttcaccaagttccgagccaccaaggggctgaaaacc
aactgttgtgactactgtggactttatatatacaataaaggcatgcccgtggagtacctc
ttccatgaaggccagcaaaagcgcttctgcaactctagctgtctcaacagttacaagaag
aagaacactcgagtctacccttgcatgtggtgcaagacgctgtgcaaaaactttgacatg
ctgcccaatgtggatcgcagtggcaagatgggactgttctgctccatttgctgcactacc
tcccacaaagtgaagcagtcgggcttggttggtccccctaggccctgcagcttctgcaga
aagagtttatctgaaccctgctattacaacaagacagaccgggttgtctaccaattctgc
agccccagctgctggaccaaattccagcacaccagcccggaaggtgggatccacctgaac
tgccattactgccacaatcttttcaccgggaagccagagatcctagactggcaggacaag
atgtatcagttctgctgcaaggattgctgtgaggacttcaagcggctacgaggggtagtg
tctcagtgtgagcactgcaagcaggagaagctgctgcatgagaagatccgcttctcaggg
gtggagaagaacttctgcagcgaagggtgtgtgcttctttacaaacaggatttcaccaag
aacctgggcctgtgctgcatcacctgcacctactgttctcagacctgccagcgggcggtc
accgagcagctggagggcagcacctgggacttctgtagtgaagactgcaaaagcaaatac
ttgctctggtacttcaaggcagctcggtgccatgcctgcaagcgtcaggggaagctgctg
gaaaccatccactggcgagggcaaatcaaacacttctgcaaccagcagtgtctgctgcga
ttttacaatcaacagaaccagcccaacctggacacgcagaaggggcccgagagcctgctg
aacagtcaatcttcagaaacaaaaccacccgctccttcccatcagaaggcagagactaac
acgttgtcatcaaagacctcctcagcccacatgtctccagccgcgccgcctcctccgccc
cctccagttccagccacccctcggaagaacaaagctgccatgtgcaaaccactgatgcag
aaccggggtgtttcctgcaaagtagaaatgaagtccaaaggatgtcagacagaggctgac
tggaagccccaggtgattgtgttgccaatcccagtcccgatcttcgtgcctgtgcctatg
catatgtactgccagaaagtacctgtgcctttctccatgcctgtcccggtgcctgtgcca
atgtttctacccaccacactggagagcgcggataagattgtagagacaattgaggagctg
aaggtgaagatcccctccaatcctctagaggctgacatcctggccatggcagaaatgatt
gcagaggctgaggaactggacaaagcctcctcggacctgtgcgacctggtgagtaaccag
agcgcagagggtctcctggaggactgtgatctgtttggaccagcgagggacgatgtgttg
gctatggctgtcaagatggcaaacgtcctcgatgagccaggccaggacctggaggctgac
ttccctaagaaccctctatacatcaaccctagtgttgatttcctctttgactgtgggctg
gtgggcccagaagatgtgtccacagagcaagagctgcctcgtgctgtccgaaaggggcag
aagcgtctggtgctctctgaaagctgttcccgggactcaatgagcagtcagcccagctgc
acagccctgaactactcatatggtgtgaatgcctggaagtcctgggtgcaagccaagtat
gcagggggagagaccagcaagggagaggagctgcgctttggccccaagcccattaggatc
aaagaagacatcctggcctgcacagcagctgaactcaactacggcctggctcagtttgtc
aaggaaataacgcggcccaatggagagcgctatgaaccagacagcatctattacctttgc
cttggcatccagcagtacctgcttgagaacaatcgtatggtgaatatatttacagacctt
tactacctgaccttcgtgcaggagctgaacaagtccctgagtggctggcaacccacagtc
ttaccaaacaacacagtcttctcacgtgtcgaggaggagcacctctgggagtgcaagcag
ctgggcgtttactcaccctttgtgctcctcaacacccttatgttcttcaacactaagttc
tttgggctgcagacagcggaggagcacatgcagctctccttcaccaacgtggtacggcag
tcccgcaagtgcaccacagcccgtggtgtcaccaagatggtgagcatccgctactgcgct
cctgccaagcagaagaaaggccgagatggtagcactggaaagaggaagcgtgaggaggag
atgccaatgttggagcagcgggagaacaagatgaacccgcttcgatgccccgtcaagttc
tatgagttttatctctctaaatgtcctgagagcatgcggaaccgcagcgacatcttctac
ctgcagcctgagaggtcgtgcatcgccgagtccccactttggtattcagtcatccccatg
gacaggagcatgctggaaagcatgctgaaccgtatcctggtggtgagggagatctacgag
gagcacagccggctcagcagcctggaggatgatatggactaa

DBGET integrated database retrieval system