KEGG   Gallus gallus (chicken): 422231
Entry
422231            CDS       T01006                                 

Gene name
STK26
Definition
(RefSeq) serine/threonine-protein kinase 26
  KO
K08838  serine/threonine-protein kinase 24/25/MST4 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    422231 (STK26)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    422231 (STK26)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     422231 (STK26)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE20 family
   422231 (STK26)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    422231 (STK26)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF1241 Pkinase_fungal Kinase-like DEK_C Kdo DUF5089
Other DBs
NCBI-GeneID: 422231
NCBI-ProteinID: NP_001026288
CGNC: 51666
Ensembl: ENSGALG00000006049
UniProt: Q5ZMA7
Position
4
AA seq 416 aa
MAHSPVAVQVPGMQNHRADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA
EDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRAGPFDEFQ
IATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFV
GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLL
GEFSKPFKEFIDACLNKDPTFRPTAKELLKHKFIMKNAKKTSYLTELIDRFKRWKAEGHS
SDESDSDGSDSESSNKENNSHPEWSFTTVRKKPDAKKLQNGTDQDLVKTLSCLTMIITPV
FAELKQQDTNNASRKKAIEELEKSINMAEATCPGITDKMVKKLMEKFQKFSVNDSS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcccactcgcccgtggcggtgcaagtgcccggcatgcagaatcatagagcagaccca
gaagaattattcacaaaactggaacgcattgggaaaggctcctttggtgaagtctttaaa
ggaattgataatcggacacagcaagtggttgctataaaaatcatagacctcgaggaagca
gaagatgaaatagaagatatacagcaagagataactgttttaagtcagtgtgatagtcct
tacgtaacgaaatactacggatcatatttaaagggcacaaaactatggataataatggaa
tacttgggtggaggatcagctttggatcttcttcgtgctgggccttttgatgagttccag
atagctactatgctaaaggaaatcctgaaaggtcttgactacctgcactcagagaagaag
attcacagggatataaaagctgccaacgtcttgttatcagagcaaggtgacgttaagctt
gctgattttggagttgctgggcagttgacggacacgcaaattaagaggaatacctttgtt
ggaactccattttggatggcccctgaagttattcagcagtcagcatacgattccaaagct
gacatctggtcattgggaatcactgctatcgaactagccaaaggggagccacccaactct
gatatgcatccgatgagagttctgtttctcattccaaaaaacaatcctccaactttatta
ggagaattcagtaaaccttttaaagagttcatcgatgcgtgtctcaataaggatccaaca
tttcgccctacagcaaaagaactcctgaagcacaaattcattatgaaaaatgccaagaag
acttcatacctgacagagctaattgataggtttaagagatggaaagcagagggacatagt
agtgatgagagtgattccgatggttctgattcggaatcaagtaacaaagaaaacaactct
catccggagtggagctttactacagttcggaagaaaccggatgcaaagaagctgcagaat
gggacggatcaagatcttgttaaaaccttgagttgtttaactatgataatcactcctgtc
tttgctgagctcaagcagcaggacacaaataatgctagcagaaagaaggcaattgaggaa
cttgaaaaaagcatcaatatggcagaagcaacatgtccagggatcacagataagatggtg
aagaaacttatggagaaatttcagaaattttctgttaatgactcatcctaa

DBGET integrated database retrieval system