KEGG   Gallus gallus (chicken): 422251
Entry
422251            CDS       T01006                                 

Gene name
ZIC3
Definition
(RefSeq) zinc finger protein ZIC 3
  KO
K18487  zinc finger protein ZIC 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    422251 (ZIC3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    422251 (ZIC3)
SSDB
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_4 zf-met zf-C2H2_6 zf-C2H2_8 Zf_RING zf-H2C2_5
Other DBs
NCBI-GeneID: 422251
NCBI-ProteinID: XP_015133964
CGNC: 51676
Ensembl: ENSGALG00000031144
UniProt: A0A1D5PRL4
Position
4
AA seq 464 aa
MTMLLDGGPQFPALGVGGFAAPRHHEMPGRDPAAGMGLGPFGDSSHAAAAFKLNAAPHDL
AAGQSSAFTPQAPGYASALGHHHHHHHHHAGQVPSYGGAAAFNSTRDFLFRNRGSGIADA
GSGTAQHGLFGGSPGGLHGPGGIPDSPGYLLFPGLHEQSPSHTSPGGHVDNGQMHLGLRG
DLFGRPDPYRAVSSPRTDPYGGAQFHNYNHMNMNMGVNVAAHHHHHHHHHGPGAFFRYMR
QPIKQELSCKWLDESHLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHICYWDECPR
EGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEG
CDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPAASSG
YESSTPPAVGSAGSKDSTKTPPAALQGNPGHNPGLPPNFNEWYV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgacgatgctgctggacggagggccgcagttcccggcgctgggggtgggcggcttcgcg
gcgccccgccaccacgagatgccgggccgcgaccccgccgccgggatgggactgggcccc
ttcggggactcctcgcacgccgccgccgccttcaagctgaacgcggccccgcacgacctc
gccgccgggcagagctccgcgttcaccccccaggctcccggctacgccagcgcgctcggc
caccaccaccaccaccaccaccaccacgccggccaggtgccctcgtacggcggggccgcc
gccttcaactccacccgcgactttctgttccgcaaccgcggctccgggatcgcggacgcg
ggctccggcacggctcagcacggccttttcggcggctctcccggaggtttgcacggcccc
ggcggcatcccggacagcccgggctacctgctcttccccgggctccacgagcagagcccg
agccacacgtcccccggcgggcacgtggacaacgggcagatgcacctggggctgcgcggg
gacctcttcgggcggccggatccgtaccgcgccgtctccagcccccgcacggacccttac
ggcggggcccagttccacaactacaaccacatgaacatgaatatgggcgtgaacgtggcc
gctcatcaccaccaccaccatcaccaccacgggcccggggctttctttcggtacatgcgg
cagcccatcaagcaagagctgtcctgcaagtggctcgacgagagccatctcagccggccc
aagaagagctgcgacaggactttcagcaccatgcacgagttggtcacccacgtcaccatg
gagcacgtcgggggtccggagcagaacaaccacatctgctactgggacgagtgcccgcgg
gaaggcaaatccttcaaggcgaaatacaaactggtcaaccacattcgggtgcacacgggg
gagaagcccttcccctgccccttccccggctgcgggaagatctttgcccgctccgagaac
ctcaagatccacaagcggacgcacacaggtgagaagcccttcaagtgcgagtttgagggc
tgcgaccggcgcttcgccaacagcagcgacaggaagaaacacatgcacgtccacacctcg
gacaagccctacatctgcaaggtgtgcgacaaatcctacacccaccccagctcgcttagg
aaacacatgaaggtgcacgaatcccagggctcggactcttcccctgcagccagttcaggc
tatgagtcctccacccccccggcggtgggctcggccggcagcaaggactccacgaaaacg
ccgccggcagccctgcaagggaaccccggccacaaccccggcctgccccccaattttaac
gagtggtacgtgtga

DBGET integrated database retrieval system