KEGG   Gallus gallus (chicken): 422260
Entry
422260            CDS       T01006                                 
Symbol
SYTL4
Name
(RefSeq) synaptotagmin-like protein 4
  KO
K17598  synaptotagmin-like protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    422260 (SYTL4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    422260 (SYTL4)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     422260 (SYTL4)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    422260 (SYTL4)
  Small GTPases and associated proteins
   Rab associated proteins
    422260 (SYTL4)
SSDB
Motif
Pfam: C2 FYVE_2 FYVE Prok-RING_4 DUF5446
Other DBs
NCBI-GeneID: 422260
NCBI-ProteinID: XP_003641124
CGNC: 5121
UniProt: A0A3Q3AZS9
Position
4:5162185..5169985
AA seq 690 aa
MSEAVDLSFLSDVEKDLILQVLQRDEELRKAEERRIRRLKNELLEIRRKGAKRSSQRYSE
RTCARCQQSLGRISPKANTCRGCNHLVCRDCRSYGPNSSWRCKVCTKEAELKKTTGDWFY
DQRVNRFANRLGSDMVRLSLRHRSAASKRETVGQTLLQKAQLGDPKGSSAARQKSPQEPW
KVPSLFPDASDLREGKSDTESMENMSLDGYRPAPAAGGGRRNSLDKATTIKEGKQVAGPA
GPTAASLTLPLPSRNVPSVTNGRETPTGSRSSTLVNDHEAIFKKNPRRVVRPADYTKSVI
DLRPEEFVGESSSMGDRSKSVPGLTTELDEEEEDIDNLVEIHRQRVARGSMRSGTSSSTL
GSMVSIYSEAGDFGNIAVTGGISFSLSYEQKTQTLFIHVKECRQLAYGDEAKKRSNPYVK
TYLLPDKSRQGKRKTTIKRNTVNPLYNELLKYEINKSLLLTRTLQFSVWHHDRFGRNTFL
GEAEIPMDSWNFDSQLEEFLLLHGKTGVDAAGLPQYKGELVVSMKYIPSSKHTGAGNGRK
GKAGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPHKNKASKRKTPVVKKTLNPHYN
HTFVYNGINPEDLQHICLELTVWDREPLSSNDFLGGVRLGVGNGMSNGQAVDWMDSTGEE
LNLWQKMRQYPGSWAEGTLQLRSTMAKLRP
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgtcggaggctgtggatctgtccttcctgtcggacgtcgagaaggatttgatcctgcag
gtcctgcagcgcgatgaggagctccgtaaagcggaggagaggagaatcaggcgcctgaag
aatgagctgctggagatccggcgcaaaggggccaagcggagcagccagcgctacagcgag
cggacctgtgcccgctgccagcagagcttgggccgcatcagccccaaagccaacacctgc
cggggctgcaaccatttggtgtgccgggactgccgctcctacggccccaacagctcctgg
cgctgcaaagtctgcaccaaggaggcggagctgaagaagacaacaggggactggttctac
gaccagagggtcaaccgctttgccaacaggctgggcagcgacatggtacggctgtctctg
cggcacaggtctgcagcgagcaaaagggagacggtgggacagactctcctgcagaaagca
cagcttggtgaccccaagggctcctctgcagcccggcagaagagcccccaggagccctgg
aaagtgcccagtttgtttcctgatgcctcagaccttcgggaaggcaaaagtgacacagag
tccatggaaaacatgagcctggatggctacagacctgctcctgctgccggggggggcaga
aggaactctctggataaagccaccactatcaaagagggaaagcaggttgctggaccagca
ggacccacggcagccagcctgacactccctctgccctccagaaatgtgccttctgtcacc
aacgggcgggagactcccacaggcagccgaagtagcacgttggtgaatgatcacgaagcc
atcttcaagaagaacccccggagggtggtgagacccgcagactacaccaagtcagtgatc
gacctgcgcccagaggaatttgtgggtgaaagcagctccatgggagacaggagcaagtca
gtgcccggcctcaccacggagctggatgaggaggaggaggacattgacaacctggtggag
atccatcggcagcgggtggcacggggcagcatgcgcagtggcacctcctcgagcacgctg
gggagcatggtcagcatctacagcgaggctggtgacttcgggaacattgcagtcactgga
ggaatctccttctccctgagctacgagcagaagacacagacgttgttcatccatgtgaag
gagtgccggcagctggcctatggggatgaggccaagaagcgctccaacccgtatgtgaag
acttacctcctgcctgacaaatcccggcaagggaagcgcaagacaaccatcaagcgcaac
actgtaaacccgctgtacaacgagctgctgaagtatgagattaataaatccctcctgctc
acgaggacgctgcagttctcagtctggcaccacgatcgctttggccgcaacacattcctg
ggggaggcggagatccccatggactcctggaactttgacagccagctggaggagtttctg
ctgctgcatgggaagactggggtggatgctgctggcctcccccagtacaaaggggagctg
gtggtctccatgaagtacatcccatcttccaagcacaccggggctggaaatggcagaaag
ggcaaagcaggagaaggtggtgagctccaggtctggattaaagaagccaagaacctcaca
gctgccaaatcagggggcacatcggacagctttgtgaagggctacctcctgccacataaa
aacaaggcctctaagaggaagacgcccgtggtgaagaagaccctcaatcctcattacaac
catacctttgtctataatggcatcaaccctgaggacctgcagcacatctgcctggagctg
actgtctgggaccgggagcctctgtccagcaatgacttccttggaggtgttcgcctgggc
gtgggcaatggcatgagcaatgggcaggccgtggactggatggactccacgggtgaggag
ctgaacctgtggcagaagatgcgccagtacccaggctcgtgggcagaggggacgctccag
ctccgctccaccatggccaagctgaggccctag

DBGET integrated database retrieval system