KEGG   Gallus gallus (chicken): 422269
Entry
422269            CDS       T01006                                 

Symbol
ZNF711
Name
(RefSeq) zinc finger protein 711
  KO
K24376  zinc finger protein 711
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    422269 (ZNF711)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    422269 (ZNF711)
SSDB
Motif
Pfam: Zfx_Zfy_act zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zinc_ribbon_15 zf-C2H2_6 zf-C2H2_11 ARS2
Other DBs
NCBI-GeneID: 422269
NCBI-ProteinID: XP_025005807
CGNC: 51681
Position
4:complement(8672550..8695985)
AA seq 807 aa
MDPGGGSLGLQTQESKMPHAMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGI
TLDHGLAAEVVQGPDIITETDVVTEGVIVPDSVLETDVAIEEALDTSDHVLTSDLITEAV
RVPDQVFVADLVTGPDGHLEHVVQDSVSAADSPTMVSEEVLVTNSDSEAVVQAAGTVPGS
TVTIKTEDDDDGKSTSEDYLMISLDDVGEKLDHIGSTPLKISTEVTNDEVAKDDGFGSEV
IKVYIFKAEAEDDVEIGGTEIVTESDFHNGHSVAGVIEQGGVGRMQREKMVYMAVKDSSQ
EDEDISCAEIADEVYMEVIVGEEEATSLPDTQLEETGVNKTFVPVAWAAAYGDDRRLPRR
YEDGQAAGNNLDTRLENKNGNATQYLQICDSISTNRVLKQKTKKRRRGEARQWQTAVIIG
PDGQPLTVYPCHICGKKFKSRGFLKRHMKNHPDHMIKKKYQCTDCDFTTNKKVSFHNHLE
SHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKLHKCKYCDYETAEQGLLNRH
LLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQHCVFRCADQSNLKTHIKT
KHGNDLPFKCEHCPQAFTDEKELQQHTELFQGHKTHQCPHCDHKSTNSSDLKRHIISVHT
KDFPHKCEVCEKGFHRPSELKKHSETHKGKKIHQCRHCDFKTSDPFILSGHILSVHTKDL
PFKCKRCKRGFRQQTELKKHMKTHSGRKVYQCQYCEYSTTDASGFKRHVISIHTKDYPHR
CEYCKKGFRRPSEKNQHIMRHHREAIM
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggatccgggtggtggaagtcttggattgcaaacacaagaatccaaaatgcctcacgcc
atgattatgcaggacttcgtggctggaatggccggcactgctcatattgatggagatcat
attgttgtgtcggtccctgaagctgtccttgtttctgatgttgttactgatgatggaata
actcttgaccatggcttagcagctgaagttgtgcaaggacctgacatcatcactgaaact
gatgttgtaacagagggtgtcattgttcctgattctgttctggaaactgatgtggctatt
gaagaagcactagataccagtgatcatgttctgacttctgatctaataacagaagctgtt
agagttcctgatcaggtgtttgtggctgaccttgttacgggtcctgatggacatttagag
cacgtggtgcaagactccgtgtcagcagctgactcacctacaatggtctcggaagaagtc
cttgtaacgaactcagattctgaagcagtcgttcaggcagctggtactgttcctggctct
acagtgactataaaaacagaagatgatgatgacggcaagagtacatctgaagactactta
atgatatctttggatgatgttggagaaaaactggaccacataggaagcactcccttgaaa
atcagtactgaggtgacaaatgatgaagtggctaaagatgatgggtttggttccgaagtt
atcaaagtatacatatttaaagctgaagctgaagatgatgttgaaataggtgggacagaa
attgtcacagagagtgattttcacaatggacattcagtagctggagtaattgaacaagga
ggtgttggtagaatgcagcgagaaaaaatggtttacatggctgttaaggactcttctcag
gaagatgaagatattagctgtgctgaaatagcagatgaagtttacatggaagttattgta
ggtgaagaagaagctacatcacttccagacacacagctcgaagagactggtgtgaataaa
acttttgttcctgttgcttgggctgctgcttacggagatgacagaagactacccagaaga
tatgaagatggtcaagcggcagggaataacttggatacacgattagaaaacaaaaacggt
aatgcaacacaatacctgcagatttgtgatagcattagcactaatagagtgctaaaacaa
aaaaccaagaaaaggaggagaggagaggccaggcaatggcaaacagctgttataataggt
cctgatggacagcccttaacagtttacccttgtcatatatgtgggaaaaaatttaaatcc
agaggattcttgaaaaggcatatgaagaatcatccagatcatatgattaagaagaaatac
cagtgtacagactgtgactttacaactaacaaaaaagtaagtttccacaatcatctggaa
agccataaacttataaataaagttgataaaacccacgagtttacggaatatacaagaaga
tacagagaagcaagcccgttgagttctaataaactaatactgagggacaaagagcctaaa
ctgcacaagtgcaaatattgtgactatgaaaccgcagagcaggggctactcaatagacat
ctacttgcagttcacagtaagaacttccctcacgtatgtgtggagtgtgggaaaggattc
cgtcatccgtcagagctgaaaaagcatatgaggacccacactggggaaaagccataccag
tgtcagcactgtgtcttcaggtgtgctgatcagtccaatctgaaaactcatatcaaaacc
aaacacgggaatgacttgccatttaaatgtgagcactgtccccaggcttttacagatgaa
aaggagctgcagcagcacacggaattgtttcaagggcataagactcatcagtgtccacac
tgtgaccataagagcaccaactccagtgacctgaagcgacacattatttcagttcataca
aaggattttccccacaaatgcgaggtatgtgaaaaaggcttccatcgtccatcagagctc
aaaaagcatagtgaaacccataaaggtaaaaagatacatcagtgtagacactgtgacttt
aaaacgtcagatccttttatactgagcgggcacatcctctcggttcacaccaaggacctg
ccttttaaatgcaaaagatgtaaaagaggatttaggcagcaaactgaacttaagaagcac
atgaagacccacagtggaagaaaagtttatcaatgccagtattgcgaatatagcactacg
gatgcgtcaggctttaaacgacacgtaatatcaatacacacaaaagactatccacatagg
tgtgagtattgcaaaaagggattccgtagaccatcagaaaaaaatcagcatataatgagg
caccacagagaggccataatgtaa

DBGET integrated database retrieval system