KEGG   Gallus gallus (chicken): 422297
Entry
422297            CDS       T01006                                 

Gene name
VAMP7
Definition
(RefSeq) vesicle-associated membrane protein 7
  KO
K08515  vesicle-associated membrane protein 7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    422297 (VAMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    422297 (VAMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    422297 (VAMP7)
Membrane trafficking [BR:gga04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    422297 (VAMP7)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   422297 (VAMP7)
SSDB
Motif
Pfam: Synaptobrevin Longin
Other DBs
NCBI-GeneID: 422297
NCBI-ProteinID: NP_001026292
CGNC: 5637
Ensembl: ENSGALG00000007476
UniProt: Q5ZL74
Position
4
AA seq 220 aa
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
IYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSES
KGTDQVAETQAQVDELKGIMVRNIDLVAQRGEKLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIVSIVIIYIIVSAACGGLAWPSCVQK
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctattctctttgctgttgtggcgaggggcacaaccatccttgccaagcatgcctgg
tgtggaggaaacttcctggaggtgacagagcagatcctggcaaagataccttctgaaaac
aacaaactgacctattcacatgggaattatctgtttcattacatctgccaagacaggatt
atatacctctgcatcacagatgacgactttgaacgttccagagccttcaacttcctgaat
gaaatcaagaagaggtttcagaccacgtatggctcaagagcacagacagcccttccctat
gcaatgaacagcgagttctccagtgtcttagctgcacagctgaaataccactcggagagc
aagggcactgaccaggtagcagagacacaagcccaagttgatgaactgaaaggaatcatg
gttcgaaacatagaccttgtggcacagagaggagagaagctggagttgctgatcgataaa
acagagaatctcgtggattcctcagtcactttcaaaactaccagcaggaaccttgctaga
gccatgtgtatgaagaacctcaagcttaccatcattatcatcattgtatcaattgttatc
atctatatcatcgtatcggctgcctgcggtgggcttgcgtggccaagctgtgtgcagaag
taa

DBGET integrated database retrieval system