KEGG   Gallus gallus (chicken): 422330
Entry
422330            CDS       T01006                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    422330 (FGF16)
   04020 Calcium signaling pathway
    422330 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    422330 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    422330 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    422330 (FGF16)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   422330 (FGF16)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   422330 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 422330
NCBI-ProteinID: NP_001038115
CGNC: 5902
Ensembl: ENSGALG00000007806
UniProt: Q197G3
Position
4
AA seq 207 aa
MAEVGGFLGALDPDLHGFPPALGGLPLADSPGFLNERLGQIEGRLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRQDHSRFGILEFISLAVGLVSIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHPDSERHYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPAKIPAVYRDLFHYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggccgaggtgggcggcttcctgggcgcgctggaccccgacctgcacggcttccccccc
gcgctgggcgggctgcccctcgccgattcgcccggcttcctcaacgagcgcctggggcag
atcgaggggcggctgcagcggggctcccccaccgacttcgcgcacctcaagggcatcctg
cggcggcggcagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacggcacccggcaggaccacagccgcttcgggattttggagttcatcagcctggca
gtggggctggttagtatccgtggggtggattcaggactctacctcggcatgaacgagaga
ggcgagctgtatgggtcgaagaagctcacaagggaatgtgttttccgagagcagtttgaa
gagaactggtacaacacgtacgcctcaacgctctacaagcatccagactcggagaggcat
tactacgtggctctgaacaaggacggctccccccgcgaggggtacaggactaagagacat
cagaaattcactcactttttaccgaggcccgtggaccctgccaaaatacctgcagtgtac
agagacctcttccactacaggtga

DBGET integrated database retrieval system