KEGG   Gallus gallus (chicken): 422347
Entry
422347            CDS       T01006                                 

Gene name
IRS4
Definition
(RefSeq) insulin receptor substrate 4
  KO
K07187  insulin receptor substrate 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04140  Autophagy - animal
gga04910  Insulin signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    422347 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    422347 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    422347 (IRS4)
   04920 Adipocytokine signaling pathway
    422347 (IRS4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    422347 (IRS4)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   422347 (IRS4)
SSDB
Motif
Pfam: IRS PH PH_11 PH_2
Other DBs
NCBI-GeneID: 422347
NCBI-ProteinID: XP_003641132
CGNC: 51714
Ensembl: ENSGALG00000008107
UniProt: F1NDQ2
Position
4
AA seq 1164 aa
MASGMNGPGGGGGAGAAVRGGEEEPGARHAGGGAVPQQREPGAAGEGEPAAGDGGRCPSP
QPHHLLLLLRRSPSASLCPPAEGPAGRAALGRGGQPPPAGRAAPPASSSGGDDVRKCGYL
RKQKHGHKRYFVLRADSPLAPARLEYYDSEKKFKSSLRAGGGGAAPVCCPPPKRVIPLYQ
CFTVSRRADAKHKHIIALYTKDEYFAMLAENEAEQEAWYEAISELMSQTKRGCLEQEDQA
EQQVDEDDEHYGTSLRPGTVFKEVWQVNVKPKGLGQTKNLTGVYRLCLSSKAIHLVKLNS
EVPSVHLQLMNIRRCGHSENFFFIEVGRSASIGPGELWMQVDDSVVAQNMHETFLETMKA
LKAFAEFRPRSKSQSSGGGGGTNPISFITTRRHLGNLPPSQTGLQRRSRTESVVGGTPPT
TKSSNSYRFRTSSEGEGTMTRPFRSVTGSLIHLNTARMNLGRQEGSGRYVRAAFSSSYHT
RSASLPVSHFPSTTSPISVSSSSGHGSASDMLTRPSSSSVCGSPSDGGFISSDEYGSSPG
DFRYFRVRSNTPDSLGNTPPIREENCLSEYMSMSKQQADDNSRDDYMEAEKCFRKRTYSL
TKPTSVAVQQKTTQTTALLDEDSVGNHGRLLYSETSKLKGNHELEYSDSNLDSICNQSRS
KARDDGYMPMMPGVASSLSSNSDYLPMTPKSMSVPKQINNSWSPSQVDSRGYMMMFPKAS
SSPVRSPLTGFISKGSNEKIVNNEYMDMSPGNSAPKHPGDSNYIHTSSASKGFSSYFSLP
RSFKALTGQNGDHSEYVPMSSPGKLLYGGPENVKSTNSEVLSNGISKSPVAKGSDEGLVQ
NRATRPTRLPLGTRGSNTIPRMYDRTVPPEPASPGEYINIDFNEKASNTPYSLSAEGSPS
SLGSSSDHRQSPLSDYMSVDLDVQSPKVAKELSNSLTDISIYASSSIPRNQQNPDYARLS
FGTACVSAANNRTDDYTEMTFNMAATPPRPFAAESDDGVKMDSPSSIVNRLCIVDRYAGS
SSFSVPSAEPPMGPKVIRADPQGRRRHSSETFSSAGTVTTSSSFFTDSSKRHSSASFDNV
WLKPDESISDGQESKMSRDTSTGFQNGLNYIALNLCDDPISCEASTGTPTCHLQNGTSSL
DSGAYVSIDFTRSDGLKCNAARKD
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggcgagcggcatgaacggcccgggcggcggcggcggcgccggcgcggcggtcaggggc
ggcgaggaggagccgggcgcccggcacgcaggaggcggagccgtgcctcagcagcgggaa
cccggtgcggcgggcgagggggagccggcggcgggggacggtgggcgctgcccgtccccg
cagccccaccacctgctgctgctgctgcggcgctctcccagcgcttcgctctgtccgccc
gcggagggccccgcgggccgcgccgccctgggccgcggcgggcagcccccccctgcgggc
cgcgccgcacccccggcctcgtcctccggcggcgacgacgtgaggaagtgcggctacctg
aggaagcagaagcacgggcacaagcggtacttcgtgctgcgggccgatagcccgctggcc
cctgcccgcctggagtactacgacagcgagaagaagttcaagagcagcctgcgggcgggg
ggcggcggggcggcccctgtctgctgcccaccgcccaagcgggtcatcccgctctaccag
tgcttcaccgtcagccggcgcgccgatgccaagcacaagcacatcattgccttgtacacc
aaggatgagtactttgctatgctggcggagaatgaggccgagcaggaggcctggtacgaa
gccatcagcgagctgatgagccagaccaagaggggctgcctggaacaggaggaccaggcg
gagcagcaggtggatgaggacgacgagcactacgggacctccctgaggcctggcactgtc
ttcaaggaggtgtggcaggttaacgtgaagcccaaagggctgggccagacgaaaaacctc
actggagtgtatcggctgtgcctctccagcaaggctatccaccttgttaagcttaactcg
gaggtgccctctgtccacctacagctgatgaatattcgccgctgtgggcactcagagaac
ttcttcttcatcgaagtgggcagatcagcctccatcgggcctggagagctctggatgcaa
gtggatgattctgtggtggcccagaatatgcacgagacttttttggagaccatgaaagcg
ctcaaagcctttgcagagtttaggccccgaagcaaaagccagtcttctggtggtggtggt
ggtaccaatcccatctccttcatcaccactaggaggcacctgggcaacctgccccccagc
cagacgggcttacagagaagatcgagaactgagagtgtagttggagggacgcctcctacc
accaagagcagcaactcctaccgcttcaggacatccagtgagggagaaggaaccatgact
agacctttcaggtcagtgacagggagcctgatccacctcaacactgcaaggatgaatttg
ggccggcaagaagggagtggaaggtacgttagagctgcattcagctcatcatatcacact
aggtctgcttcgctgcctgtgtctcattttccctccactacgagtcctatcagcgtttct
tccagcagtggccatggctctgcttcagacatgttgaccaggccttctagctcgtctgtt
tgtggctctccaagtgatgggggatttatctcttctgatgagtatggctccagccctgga
gatttcaggtactttagggtccggagtaatacaccggattccttgggaaacacaccgcct
atcagagaggagaattgtctgagtgagtacatgtccatgagtaagcagcaagcagacgat
aactcaagagatgattatatggaggctgaaaagtgtttcagaaaaagaacttactctcta
actaaaccaacttcggtagcagtgcagcagaaaacaacacaaactacagctttgttagat
gaagattccgtaggaaatcatggacgattactttactctgaaacatcaaaattgaaaggt
aaccatgaattggagtacagtgacagtaatcttgattctatatgcaaccaaagcaggagt
aaagccagggatgatggatacatgccaatgatgccaggcgttgcgtcctctctgtcaagt
aacagcgattatttgccaatgactcctaaaagtatgtctgttccgaagcagattaacaat
tcatggtcaccatctcaggtcgactcaagaggatatatgatgatgtttccaaaggcaagc
tcttcacctgtacggagtcctttaactggatttatttctaaaggtagtaacgagaagatt
gtcaacaatgaatacatggatatgtcacctggtaattcagctccaaagcatcccggtgat
tcaaattatatacatactagttctgcctccaaaggtttcagttcatatttttctttgcct
cgaagctttaaggcattaacaggacaaaatggtgaccacagtgaatatgttccaatgtct
tcacctggaaaactcctgtatggtggaccagaaaatgtaaaaagcaccaacagcgaagtt
ttgtctaacggcatctctaagtcaccggtggcaaaaggttcagatgaaggactggtgcag
aacagggctacacggccaacaagactccccctcggtacaagagggagtaatactatccca
agaatgtatgatcgcacagttccacctgagccggcaagtcctggtgaatacatcaatatt
gattttaatgagaaggcaagtaatacaccgtattccttatctgcagaaggatcgccatca
tctctgggctcaagtagtgaccacaggcagtccccactctcagattatatgagcgtagac
ttggatgtacagtcaccaaaagtagcgaaagaactatctaactctttaacagatatttca
atttatgcaagttccagtattcctagaaaccaacaaaatcctgactatgctaggctctcc
tttggtactgcatgtgttagcgctgcgaataacaggactgatgattacacagagatgaca
ttcaacatggcagcaacgccacctcgaccctttgctgccgaatccgatgatggtgtaaag
atggatagtccttcttccatagttaacagactgtgcattgttgatcgatatgctggtagc
agtagtttttctgttcctagtgctgagcctccaatgggaccgaaagttatccgagctgat
cctcaaggcaggaggagacacagttctgaaaccttctcttctgctgggactgtgacgaca
tcctcctctttctttactgatagtagcaaaagacacagctctgcctcatttgataatgtt
tggttaaaaccagatgaaagcatttctgatggtcaggaaagcaaaatgtccagggatacc
tcaactggatttcaaaatggcttaaactacatagctctgaatttatgcgatgatccaata
agctgtgaggcaagtactgggacaccaacttgccatctccaaaatggtacttcaagtttg
gacagtggagcgtatgtaagcatagacttcaccaggtctgatggtctgaagtgtaacgct
gcacgaaaagactga

DBGET integrated database retrieval system