KEGG   Gallus gallus (chicken): 422380Help
Entry
422380            CDS       T01006                                 

Gene name
NRK
Definition
(RefSeq) nik-related protein kinase
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    422380 (NRK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    422380 (NRK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     422380 (NRK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE20 family
   422380 (NRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 422380
NCBI-ProteinID: NP_001026297
CGNC: 12586
Ensembl: ENSGALG00000008970
UniProt: Q5F454
Position
4
AA seq 1236 aa AA seqDB search
MARECAARSLDGIDLAALRDPAGIFELVQVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTE
NEEEEIKLEINMLKKYSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTDLVKKT
KGNCFKEDWIAYICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TIGRRNTFIGTPYWMAPEVIACEENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPKLKSRKWSKKFLNFVESCLVKNYLHRPSTETLLKHSFIRDMQNERQVRI
MLKDHLDRTRKKKGEKEETDYDYSGSEEEDDELNEDEGEPSSIVNLPGESTLRREFLRLQ
QENKNRSDPQRQQQQLKDQEKYKKQLLTERQKRIEQQKEQRRRLEDHQRREQELRRQQEC
DQRWTEANDVQRREERCKEDKRAVEDDERFIADGQRKSEKKQKKVEDVQHNKKGHRTLPK
DQTQLLSLQHDHKQKKKEPSKSSSSAAHLPSSNTTKEAEGQRKRSDGIQPALQWPAALGH
DVMPQAKVGSGSSSSPCTPALQRAVLVQCDNFQASKDVYHSSSLSDMVTTLVSLGQDDVF
WSGNQSEEQPPKVPERTTSKFYSRDQPGQQRCHSSNSHQLSPGGHALKLNSSSSSTAGNK
PWEMASHQNSRSTSGNPGPAKGENALSQNHIQLHKKPEKVSHLGQMASPCSFAKGKDSAN
LFLKAADYSSSSDEVSSSDEDDTNHTRQLLSSRVADFSRTRVPDGIELKPQSTIAEQKDQ
VLGKQISSTQEGLWNINNQNYLLPDLLQQSQISNAAVNPPKVPLTNQEPQNKSLSKTPST
ESTPSKSSTSSTTSFTSFIDPRLLPITPPTSPVGPPCSSPSSAKPEPVRRENARKGSVVN
VNPTNIRPQSDSPEIRKYKKKFNSEVICAALWGVNLLVGTENGLWLLDRSGQGRVYSLIT
RRRFQQMDVLEGLNVLITISGKKNKLRVYYLSWLRNKILRNDPEVEKRQGWVSVGDLEGC
VHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFTSLHHKPLSVDLTVENGQR
LKVIYGSLVGFHAIDVDSGSVYDLYLPTHIQGAIRPHAIIILPNTSGMELLLAYEDEGIY
IDIYGHFTKETVLQWGEMPASVAYLQSNQVMGWGEKAIELRSVETGNLEGVFMHKKAQKL
KFLCERNDKVFFASVQSGGSSQIYFMTLGQNVLFNW
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagtgcgccgcccgcagcctggacggcatcgacctggccgcgctgcgggac
cctgcaggaatatttgaactggtgcaagttgttggcaatgggacatatggacaagtctat
aagggccgccacgttaagactgggcagctagctgcaatcaaagtgatgaatgttactgag
aatgaagaggaagaaatcaagctggagataaatatgctaaaaaagtattcccatcatcgg
aatattgctacatattatggtgcatttgtaaagaagagtcctgcaggccaagatgatcag
ctctggctggtgatggagtactgtggtgctggctccgtcactgatctggtaaagaagaca
aaagggaactgttttaaggaagactggattgcttacatctgcagagaggttctcaggggc
ttggcacatcttcatgctcatcatgtcatccatcgagatattaaaggacagaacgttctt
ctcacagaaaatgcagaagtaaaactggtggattttggtgtaagcgcccaactggatcga
actatagggagaagaaacacatttattggaacgccatattggatggcacctgaagtcatt
gcttgtgaggagaacccagactctacctacgattacagaagtgacctctggtctttggga
atcactgctattgaaatggctgaaggagctcctcccctgtgtgacatgcacccaatgaga
gcactcttcctcatcccacggaacccacccccaaagctgaaatccagaaaatggtcaaag
aaattccttaattttgttgaaagctgccttgtaaaaaattatttgcatcgtccgtccact
gaaaccttgcttaagcactcttttatccgagacatgcagaatgaacggcaagtgcgcatc
atgctgaaagaccacctggataggaccaggaagaagaaaggagaaaaagaagaaacggac
tatgattacagtggaagtgaagaggaagatgatgagctgaatgaagatgaaggagaacca
agctccatagttaatctccctggggagtcaactctccgtcgtgagtttctgaggctgcag
caggagaacaaaaaccgttctgaccctcagcgccagcagcagcagctgaaggaccaggag
aaatacaagaagcagctgctgacagagcggcagaaacgcatcgagcagcagaaagagcag
aggaggaggctggaggatcatcagaggcgagagcaagagctccgaaggcaacaggagtgt
gatcagaggtggactgaggctaacgatgttcagaggagagaggagagatgtaaggaagac
aaaagggctgtggaagatgatgaacggttcatagcagatgggcagaggaaatcagaaaag
aaacagaaaaaggtggaagacgtgcagcacaacaagaaggggcatcgaactctccccaaa
gatcagacgcaactgctgtctctccagcatgaccacaagcagaagaagaaggagccttcc
aagagttcaagttcagcggcacatcttccatcaagcaacacaaccaaagaggccgagggc
caaagaaagagaagtgatggcatccagcctgccctgcagtggcctgcggcgctggggcac
gatgtcatgcctcaggcgaaggtgggctctggtagcagctccagcccctgcacccctgca
ctacagagagccgtcttagtgcagtgtgacaatttccaggccagtaaagatgtgtaccac
agcagctcactgtcggacatggtgaccacactagtcagccttggacaggatgacgtattc
tggagtgggaatcaaagtgaagaacagcccccaaaggttccagaaaggacaacctccaaa
ttttacagcagggatcaacctggccaacagagatgccattcaagtaacagccatcaactg
tcccccgggggacatgctctgaagctcaacagcagcagcagcagcactgctggcaacaag
ccgtgggagatggcatcccatcagaacagccgatccacctcagggaatccaggacctgcc
aagggagagaacgctttgtcacagaaccacatacagctgcataagaagcctgaaaaagtt
tctcatctgggccagatggcaagcccatgttcctttgccaaggggaaggacagtgccaat
ttgttcttgaaagcagcagactattcctcctcaagtgacgaagtcagcagtagtgacgaa
gatgacacaaatcacacgaggcaactgctgagcagcagagtggcagatttctcaaggacg
agagtaccagatgggattgaactgaaaccccaaagcaccatcgcagaacagaaggatcag
gtattagggaaacagatttcaagcacccaagaaggcctctggaacataaacaaccagaac
tatctcctgccagatcttctccagcaaagccaaatttcaaatgctgctgtgaacccacca
aaagtgccactgactaaccaggaacctcagaacaaatctctgagtaagaccccatccact
gaaagtacaccttcaaagagcagcacatcatctacaacatcattcacttcattcatagat
cctcgacttctgccaatcacccctcctaccagtccggtaggacctccctgtagttctcca
tctagtgcaaaacccgagcctgtcaggagagaaaatgcaaggaagggttctgttgtcaat
gttaacccaacaaatatccgtccacagagtgacagtccagaaattcgtaaatacaagaag
aaattcaactcagaggtcatctgtgctgctttgtggggagtgaatttactggtgggaaca
gagaacggattgtggcttctggacagaagtgggcaaggaagagtttattcactgattaca
aggagacgattccagcaaatggatgttctggaaggactcaatgtgctaattactatatca
gggaaaaagaataagttgagagtctattacctgtcatggctgagaaataagattttgcgc
aatgatccagaggttgagaagcgacaaggctgggtgtctgtgggtgacctggaaggctgc
gtacactacaaagttgtaaaatatgagagaatcaaattccttgtaattgctttgaaaagc
tcagtggaggtttatgcttgggctccaaagccttatcacaaattcatggcttttaagtcc
tttacctcacttcatcacaaaccgctgtcagttgacctcactgttgaaaatggacaaaga
ttaaaagtgatctatggctctttagtaggctttcacgctattgatgtggactctggatct
gtgtatgacctctaccttccaacacacatccaaggagctattcgcccacatgccattatc
atcctcccaaataccagtggaatggaacttctactcgcctacgaagatgaaggcatctac
attgatatatatgggcatttcacaaaggaaacagttttgcagtggggagaaatgccagca
tctgtagcttaccttcaatctaatcaggtcatgggctggggagagaaggcgattgaactg
cgctctgtggaaacagggaatctggaaggagtatttatgcacaagaaagcgcagaagctg
aaatttctatgtgaaagaaatgacaaggtgttctttgcatctgtacagtcaggaggcagc
agtcaaatttactttatgactctcggtcaaaatgtactattcaactggtaa

DBGET integrated database retrieval system