KEGG   Gallus gallus (chicken): 422410
Entry
422410            CDS       T01006                                 

Gene name
CTSO
Definition
(RefSeq) cathepsin O precursor
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04142  Lysosome
gga04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    422410 (CTSO)
  09143 Cell growth and death
   04210 Apoptosis
    422410 (CTSO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    422410 (CTSO)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     422410 (CTSO)
Peptidases and inhibitors [BR:gga01002]
 Cysteine peptidases
  Family C1: papain family
   422410 (CTSO)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 422410
NCBI-ProteinID: NP_001026300
CGNC: 7127
Ensembl: ENSGALG00000009373
UniProt: Q5ZMK0
Position
4
AA seq 320 aa
MAVLAFGLALACCLLRAADAAFAVPAGAAGRPPWDGGGREEEAAALRESAKRIRLLNSPS
NDNGSAFYGKNQFSHLFPEEFKAIYLRSIPYKLPRYIKVPKGEEKPLPKKFDWRDKKVIA
EVRNQQTCGGCWAFSVVGGIESAYAIKGHNLEELSVQQVIDCSYSNYGCSGGSTITALSW
LNQTKVKLVRDSEYTFKAQTGLCHYFPHSDFGVSITGFAAYDFSGQEEEMMRVLVDWGPL
AVTVDAVSWQDYLGGIIQYHCSSGKANHAVLITGFDTTGSIPYWIVQNSWGRTWGIDGYV
RVKIGSNVCGIADTVSSVFV
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcggtgctggcgttcgggttggcgttggcgtgctgcctgctgcgagcggccgacgcc
gcgttcgcggtgcccgcgggcgctgcgggacgtcctccgtgggacggaggaggacgggag
gaagaagcggcggcgctgcgggaaagtgcaaaaagaattagattactgaattcaccatca
aatgataatggatctgctttctatggaaaaaatcagttttctcacctgtttcctgaggag
ttcaaagctatttatttaagaagcataccttacaaactccccagatacataaaagtgcca
aagggagaggaaaaacctttgccaaagaagtttgactggagggacaagaaagtcattgca
gaagtgagaaatcaacagacatgtggaggctgctgggctttcagtgttgtgggtggtata
gagtctgcctatgcaattaagggacataatctggaagaactcagcgtacagcaagttatc
gattgttcgtacagtaattatggttgcagtggtggttccacaataactgctttgagctgg
ctgaatcagacaaaagtcaaacttgtgagagattcagagtacacttttaaagctcagaca
ggactgtgccattattttcctcactctgattttggagtttcaataacaggatttgctgca
tatgacttcagtggtcaggaagaggagatgatgagagtacttgttgactggggtcctttg
gcagtaacagtagatgcagttagctggcaggattatcttggtgggatcatacagtatcac
tgctccagtggaaaagcaaatcatgctgtacttatcactggttttgacacaacaggtagc
atcccttactggattgtacagaactcttggggccgtacatggggaatagatggctacgtt
cgtgttaagataggcagtaatgtctgtggtatagcagatacagtttcatcagtatttgtt
tga

DBGET integrated database retrieval system