KEGG   Gallus gallus (chicken): 422418Help
Entry
422418            CDS       T01006                                 

Gene name
RAPGEF2
Definition
(RefSeq) rap guanine nucleotide exchange factor 2 isoform X2
  KO
K08018  Rap guanine nucleotide exchange factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    422418 (RAPGEF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    422418 (RAPGEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA PDZ cNMP_binding PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 422418
NCBI-ProteinID: XP_004940966
CGNC: 14130
Ensembl: ENSGALG00000020249
UniProt: A0A1D5PDU5
Position
4
AA seq 1652 aa AA seqDB search
MASYVDNSFRQAVMKNPAERSPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEA
NEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVV
DYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPVGKPPLPRGYHTECTKP
QLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLP
ETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANM
TMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSF
GVSPTMEKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRE
LDRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEW
FNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAA
KAKRRLITLTKPSREAPLPFILLGGSEKGFGIFVDSVDFGSKATEAGLKRGDQILEVNGQ
NFENVQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASR
YSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQ
DDSIVGLRQTKHIPPALPVSGTLSSSNPDLLQSHHRILDFNTTPDLPDQVLRVFKADQQS
RYIMISKDTTAKEVVIQAIREFALTATPDAYSLCEVSVTPEGVIKQRRLPDQLSKLADRI
QLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPT
EYIDDLFKLKSKTGCTNLKRFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCR
ECKNFNSMFAIISGLNLAPVARLRTTWEKLPSKYEKLFQDLQDLFDPSRNMAKYRNVLNS
QNLQPPIIPLFPVIKKDLTFLHEGNDSKVEGLVNFEKLRMIAKEIRHVGRMASVNMDPAL
MFRTRKKKWRSLGSLSQGSTNAAVLDVAQAGGHKKRVRRSSFLNAKKLYEDAQMARKVKQ
YLSNLDLEMDEESLQTLSLQCEPATNTLPKNTGDKRSGKSETSPVAPRAGIQQKVQQQQQ
YKVNQALQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLDRHKKQSEDTV
SSASSHLSSPPTSPQSSPRKGYALAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSMPASL
HDERRQRHSVSIVETNLGVGRIDRRIMIEPDQYSLGSYAPLSENRGLYAGATVLSSPSTE
ELSQDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHAHFDNSGDGAG
LWASGSHVDQLMFSDHGTKYSRQSQGREGLDQAQSRASWASSTGYWGEDSEGDTGTIKRR
GGKDVSVEAETSCITSIPAEEAKPAPMPAHIPVTSSTTKGHIARKEGRYREPPPTPPGYV
GIPIAEFAEGVSHPTRKPPDYNVALQRSRMVARTCETQGTSAQQQQSHGHSTSRPVNKPQ
WHKPNESDPRLAHYQSQGFPTEEDEDEQVSAV
NT seq 4959 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctacgtggataacagcttccgccaggcggtgatgaagaacccggcggagcgg
agcccccaggatttggagattgtgtattcatatttacatggaatggaagccttgtctaat
ctgagagaacatcagctaaggctgatgtgtgaaactgttcgatatgaaaggcatgaagca
aatgaagttctgtactaccctgatgatattggtacctgttggtatatcctgttgtctggc
tcagtcttcattaaagaatctatgtttcttccaagaagcagttttggcaagcgttctgca
ggaagcttcaggcgtggctgtgaatgcattgttttagagccatctgaaatgattgtggtt
gattatatggatgaaaatgaagaatattttcagcgtcaagcttctcacaggcaatctcga
aggaggtttaggaaaatcaaccaaaaaggggagcgacaaacaattattgatactgttgat
ccttatcctgtggggaagccacctctgcctagaggctaccatacggaatgcactaaacct
cagcttcctgcagatttcacaaagctgcaccttactgacagtctccacccacaggtgacc
cacgtttcatccagtcactcaggatgtagcatcacaagtgattcgggaagcagcagcctt
tctgatatctaccaggctacagaaagtgaggctggtgatatggatctcagtgggttgcca
gagacagcagtggattctgaggatgatgatgatgaagaagacattgaaagggcatcagat
cctttgatgagtagagatattgtcagagattgcttggagaaagatccaatagacaggacg
gatgatgacattgaacaactactggaattcatgcatcagttgcctgcttttgccaacatg
acaatgtcagtgaggagagagctttgtgctgtaatggtgtttgcagttgtggagagagca
ggaactattgtactgaacgatggggaagagctggattcctggtcagtcattctgaatggc
tctgtggaagtgacatatcctgatggaagaacagagatactgtgcatgggaaacagtttt
ggagtttcccctaccatggaaaaggaatatatgaagggagtgatgagaaccaaagtggat
gactgccagtttgtttgtatagctcagcaagattattgccgcatcctcaatcaagtggaa
aaaaacatgcagaaggtagaagaggaaggagagattgtgatggttaaggagcacagagag
cttgatcgcactggaacaagaaaaggtcacattgtcatcaagggaacagcggaaaggtta
acaatgcatttggtggaagaacactctgtggtagacccaacatttatagaagacttcctg
ttgacgtatcggacctttctttccagcccaatggaagtggggaaaaagttgttggagtgg
ttcaatgaccccagcctcagggataaggttacacgggtagtattgttgtgggtgaacaat
cacttcaatgattttgaaggagatcctgctatgactcgatttctggaagaatttgagaac
aatttggagagggagaaaatgggtggacatttgaggctgttaaatattgcttgcgccgct
aaagcaaaaagaagattgataaccttaacaaagccatctcgagaagcccctttgcctttt
atcttgctgggagggtcagaaaagggatttgggatctttgttgatagcgtagattttggt
agtaaagctacagaagcaggcttgaaacgtggagaccagatattggaagtgaatggtcaa
aacttcgaaaatgttcagctgtcaaaagccatggaaatccttagaaataacactcatctg
tctatcactgtgaaaaccaatttatttgtttttaaagaacttttaacacggttgtcagag
gaaaaacgaaatggtgctcctcacttgcctaaaattggtgatattaaaaaagcgagccgt
tattccatcccagatctggctgttgatgtggaacaggtaataggattagaaaaagtaaat
aagaaaagtaaagccaacacagttgggggaagaaataagttaaagaagatacttgacaag
actcgaatcagcattctgcctcagaaaccatacaatgacattggaattggccagtctcag
gatgacagcattgtaggactgaggcaaacaaagcacattcctcctgctttacctgtcagt
ggaaccctgtcatccagtaatcctgatctactgcagtctcatcaccgtatcttggacttc
aatacaactccagacttaccagatcaagttctgagggttttcaaggcagatcagcaaagt
cgctacatcatgatcagtaaggacacaacagcaaaagaggtggtcatccaggccatcagg
gaatttgctctcactgcaactcctgatgcgtattcactgtgtgaagtctctgtcacacct
gagggtgtaattaaacaaaggaggcttcctgatcagttatccaagcttgctgacaggata
cagctaagtggcaggtattacctgaagaacaacatggaaacagaaactctttgttcagat
gaagatgctcaggagttactaagagagagtcaaatttccctactacagctcagtaccgtt
gaagtggctacccagctctccatgagaaattttgagctattccgtaatattgaacccaca
gaatacatagatgacttgtttaaactcaaatcaaaaacaggctgcactaatctaaagagg
ttcgaagaagtgataaatcaagaaacattctgggtagcttcggagattctaagagaaacc
aaccagttgaaaaggatgaaaatcatcaagcatttcattaagatagcgctacactgcaga
gaatgcaagaatttcaactcaatgtttgctatcattagtggcttgaatttggcaccggtt
gcaaggctccgaactacttgggaaaaacttccaagcaagtatgaaaagctgttccaagat
ctacaggatttgtttgatccatctaggaatatggcaaaataccgtaatgtccttaacagc
caaaatctgcagccccctattattcctctgtttcctgttatcaaaaaagaccttacattc
cttcatgaaggaaacgattccaaagtggagggcttagtcaactttgagaagctgagaatg
attgcaaaggaaattcgccacgttggtcgcatggcatctgtcaacatggatcctgcttta
atgtttagaactaggaagaagaaatggaggagtttggggtctctcagccagggcagtaca
aatgcagctgtgcttgatgttgcacaagcagggggtcataaaaagcgggtccgtcgcagc
tccttccttaacgctaaaaaactttatgaagatgctcagatggcacggaaagtaaagcag
tatctctcaaacttggatctggaaatggatgaagaaagcctccagactctgtctctacag
tgtgagccagccaccaacacattgccaaagaatacaggagacaagcgatctggaaaatct
gaaacatcaccggtggctccccgggcaggaattcagcagaaagtgcagcagcagcagcaa
tataaagtaaaccaagcactgcaggtccctgctgtatctctttatccctctcgcaagaaa
gtgcccgtcaaagacctcccaccatttggcattaactccccacaagctttaaagaaaatt
ctttcattatctgaagaaggaagtctggaccgccacaagaaacaatctgaagacacagta
tcaagcgcatcttcacatctgtcttctcctcccacctcaccacagagttctccaaggaaa
ggttacgctttggctcccagtggcacagtggataacttttcagactctggtcacagtgaa
atttcttccagatctagtattgtcagcaattcctcttttgactccatgccagcgtccctg
catgatgagaggagacagaggcattctgtcagcattgtggagactaatcttggcgtggga
agaattgatagaaggatcatgattgaaccagatcaatacagcttaggatcttacgcacca
ctgtcagagaacagaggcctgtacgctggagctactgttctgtcttctcctagtacagaa
gaactgtcacaggatcagggggacagagcttcactcgatgcagctgacagtggccgtggt
agctggacttcttgttcaagtggttctcatgacaacattcaaacaatacagcaccagaga
agctgggagacgctgccttttggacacgctcattttgataattcaggcgatggggcagga
ctgtgggcctcaggcagtcatgtggaccagctgatgttctccgatcatggcacaaagtac
agccggcaaagtcaaggcagggagggcctcgatcaagcacagtccagagcaagctgggca
tcctcaacgggctactggggagaggactcggaaggtgacacaggtaccataaagcgaagg
ggtgggaaggatgtttctgttgaagctgaaaccagctgcataacatccataccagcagag
gaggcgaagccagctcccatgcccgctcacataccggtaacatcaagtactacaaagggg
catattgcacgaaaagaaggtcggtatcgggaaccacctccaactcctcctggttatgta
ggaatacctattgctgagtttgcagaaggtgtttcccatccaactagaaagcctccggat
tacaacgtagcacttcagaggtctagaatggtggcacggacgtgtgagacccaggggacg
tcggctcaacagcaacagtcacatggccattcaactagcaggcctgtgaacaaacctcag
tggcataaaccaaacgagtcagatccacgtcttgctcactatcagtctcaagggtttccc
acagaggaagatgaagatgaacaagtctctgctgtgtaa

DBGET integrated database retrieval system