KEGG   Gallus gallus (chicken): 422456
Entry
422456            CDS       T01006                                 
Symbol
GAB1
Name
(RefSeq) GRB2-associated-binding protein 1 isoform X1
  KO
K09593  GRB2-associated-binding protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    422456 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    422456 (GAB1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   422456 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_3 PH_8 PH_13 PH_9 PH_2
Other DBs
NCBI-GeneID: 422456
NCBI-ProteinID: XP_001232602
CGNC: 7516
Ensembl: ENSGALG00000009898
Position
4:30481564..30578450
AA seq 721 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRVFYLVADSEEEMNKWVRCICDICGFNPT
DEDAVKPPVSSLQASAELPLPINTSPPSMQAESSLPPPYQLINIPPLESSSSQEDPQDYL
LLINCQSKKPEPTRSHADSAKSSSSETDCNDNVPSHKNPAPSMSKQAVNGFFQQQGVYDS
PPSRTGLPLADSSLYNLPRSYSQDVLPKAASPTGTDAEGEQHVFNTPSATSSLDAQMRHI
SISYDIPPTPGGTYQIPRTFPEGTLSQTSKLETIPDIPPPRPPKPHHAADRSPVETCSIT
RTASDTDSSYCIPTAGIPPSRSNTISTVDLNIFRKEISSQDCYDIPRTFPNDRSNSLEGF
HNHFKNRSMLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQETNYVPMTPGTFDFP
LFGKQVPPPSHMGFRSSPKTPPRRSMPAEKCEPPPVDRNLKPDRKGQSPKILRPKPHGLE
RTDSQTIGDFTTRRKAKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSV
HSTTSSSDSHDSEENYVSMNPNQSTEDPNLFGSNSLDGGSSPMVKPKGDKQVEYLDLDLD
SGKSTPPRKKKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKSV
K
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgagcggcggggaagtggtctgctcgggctggctccgaaagtccccaccggagaagaag
ttgaagcgctacgcatggaagaggagatggtttgtgcttcggagcggccgtttaacagga
gatccagatgtattggaatactacaaaaatgaccatgccaagaagcctatccgtattatt
gacttaaacttgtgtcagcaagtggatgctggattaacattcaacaaaaaagaatttgaa
aacagctatatttttgacatcaacactatagacagagtcttctatttggtggcagacagc
gaggaggagatgaataagtgggttcgatgcatctgtgatatctgtgggttcaaccctaca
gatgaggatgctgtgaagcccccggtcagttctttacaagcatctgctgagttacccttg
cccatcaacacttcacctccttccatgcaagcagaatcttccctacctcctccttatcag
cttattaacatccccccactggagtcttcctctagtcaagaagatcctcaggactaccta
ctgttaataaactgccagagtaaaaaacctgaacctacgagatctcatgctgactctgca
aaatccagctcttctgaaacagactgcaatgataacgtgccctcccacaaaaaccccgct
ccatccatgagcaagcaagctgtgaatggcttttttcagcagcaaggtgtctatgactct
ccgccttctcgtactggactaccattggcagactccagcctttataacctgcctaggagt
tactcacaagatgttttaccgaaggcagcgtctccgactgggactgatgcagaaggcgag
cagcatgtgttcaataccccatcagcaacatcgtcattagacgcacagatgaggcacatc
tccattagttacgacattccccccacacctggaggtacttatcagattccacgaactttt
ccagaaggaacattgtctcagacttcaaaattggagactattccagatattcctccacct
cggccaccaaaacctcaccacgctgcggatcgatctcctgtggaaacatgtagcattact
cgcacagcttcagatactgatagtagctattgtatccctacagcaggaataccaccctca
cgcagtaataccatttcaactgtagatttgaatatctttcgtaaagaaattagttctcaa
gactgttatgatattccacgaacgtttccgaatgacagatctaattcattggagggcttc
cataaccactttaaaaacagaagcatgttgacagtgggaagtgtttcaagtgaagaacta
gatgaaaattatgtcccaatgaatcccaactctcctccacgacagcattccagcagcttc
actgaacccatccaggaaacaaattatgttccaatgacaccaggcacgtttgattttccg
ttatttggaaagcaagtccctcctccctctcacatgggtttcaggtccagtccaaagacc
cctcccagacggtcaatgcctgctgaaaagtgtgaaccaccgccagtggatcggaacctc
aagccagacagaaaaggtcaaagtcctaaaattttaagacctaaaccacatggtttagag
cgaactgattcacaaaccataggtgactttactacaagaagaaaggcaaaaccagctcca
ctagaaataaaacctctgcctgaatgggaagaattacaagccccagttagatctcctatc
accagaagctttgcacgagactcctccaggttccccatgtctcccagaccggattcagtt
catagcacaacttccagcagtgactcgcacgacagtgaagagaattatgtatccatgaat
ccaaatcagtccactgaagacccaaatttgttcggcagcaacagtcttgatggaggaagc
agccccatggtaaaacctaaaggagataagcaagtagaatatttagatctggacctagat
tcaggaaaatctaccccacctcgtaagaaaaagagcagcggttcaggcagcagtgtggca
gatgaaagagttgattatgttgtagttgaccagcagaaaacacttgcactgaagagcaca
cgagaggcatggactgatgggcgacagtctacagaatcagaaacacccacaaaaagtgtg
aagtga

DBGET integrated database retrieval system