KEGG   Gallus gallus (chicken): 422460
Entry
422460            CDS       T01006                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog-interacting protein isoform X1
  KO
K06231  hedgehog interacting protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    422460 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 422460
NCBI-ProteinID: XP_015132204
CGNC: 7558
Ensembl: ENSGALG00000009948
UniProt: A0A1D5PDP9
Position
4
AA seq 697 aa
MMLKMLPFKLLLVAVALCFFEGDAKFGESGARRRRCLNGTPPRRLKKRDRRLLSPEAPGG
AEAMCRGLYPRLSCCSRADAQGLLHAGAKILSVTNNTECAKLLEEIKCAHCSPHAQNLFH
SPEKGETSERELTLPYLCKDYCKEFYYTCRGHLPGFLQTTADEFCFYYARKDGGVCFPDF
PRKQVRGPASNSLDHMEEYDKEEEISRKHKHNCFCIQEVMSGLRQPVGAVHCGDGSHRLF
ILEKEGYVKIFSPEGDMIKEPFLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSY
TTNQERWAIGPHDHILRVVEYTVSRKNPQQVDIRTARVFLEVAELHRKHLGGQLLFGPDG
FLYVFLGDGMITLDDMEEMDGLSDFTGSVLRLDVNTDLCSVPYSIPRSNPHFNSTNQPPE
IFAHGLHNPGRCAVDHHPADVNINLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEF
KPFSSGALVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQNPATKQWQEKPLCLGNSGSC
RGFFSGPVLGFGEDELGEIYILSSSKSMTQTHNGKLYKIIDPKRPLVPEECKRTARSAQI
LTSECSRHCRNGHCTPTGKCCCNQGWEGEFCRTAKCDPACRHGGVCVRPNKCLCKKGYLG
PQCEQVDRNIRRVTRPGILDQILDMTSYLLDLTSYIV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatgctcaagatgctgccgttcaagctgctgctggtggccgtggctctgtgcttcttc
gagggggatgccaagttcggggagagcggcgcgcggaggagaaggtgcctcaacgggacc
ccgccgcggcggctgaagaagcgcgaccggcggctgctgtccccggaggcgccgggcggc
gcggaggcgatgtgccgcggcctctacccgcgcctctcctgctgctcccgcgccgacgcg
caggggctgctgcacgccggggccaagatactttctgtcacgaacaacacagaatgtgcg
aagctactggaggaaatcaaatgcgcacactgctcacctcatgcccagaatcttttccac
tcacctgagaaaggggaaacttctgaaagagaactaactcttccctacttgtgcaaagac
tattgtaaagaattctattatacttgcagaggtcacttaccaggttttctccaaactaca
gctgatgagttttgcttttactatgcaagaaaagatggtggtgtatgctttccagatttt
ccaagaaaacaagtgcgagggccagcttctaactccctggaccacatggaggaatatgac
aaagaggaagagatcagcagaaagcacaagcacaactgcttctgtattcaggaagtcatg
agcggactaaggcagcctgttggagcggtacattgtggggatggatctcatcgcctcttt
attcttgagaaagaaggatatgtgaagattttcagtcctgaaggagacatgatcaaggaa
ccttttttggatatacacaagcttgttcaaagtggaataaagggaggagatgaaagagga
ctgttaagccttgcattccatcccaattacaagaaaaatggaaagctgtatgtgtcttat
accaccaaccaagaacggtgggctattggacctcatgatcacatccttagggtggtagaa
tacacagtatccaggaaaaatccacaacaagttgatataagaacagccagagtgttttta
gaagtagcagaactacatcgaaaacatctaggagggcagcttctgtttggcccagatggc
ttcttatacgttttccttggagatggcatgattaccctcgacgatatggaagaaatggat
ggtttaagtgattttacaggttctgtattacgcctcgatgtaaatactgacctgtgcagt
gtcccttattccataccacggagcaacccacattttaatagcacaaaccaacctcctgaa
atttttgcacacggactccacaatccaggccgatgtgctgtggatcaccacccagcagat
gtaaacatcaatttaacaatactttgctcagattcaaatggaaagaacagatcttcagca
agaatcttacagataataaagggtaaagactatgaaagtgagccttcacttttagaattc
aaaccattcagcagtggagcgttggtcggtggatttgtctatcgaggttgccagtctgaa
aggctctacggaagttatgtatttggagaccgcaatggaaattttttaacgctgcaacag
aatcctgcaactaaacagtggcaagagaaacccctctgtcttggcaacagcggttcatgt
agaggtttcttttcaggccctgtcttgggatttggtgaagatgaactaggcgagatttac
atattatcaagcagtaaaagtatgacacagactcacaatggaaaactctacaagatcatt
gacccaaaaaggcctttagttcctgaagaatgcaaaagaacagctcggtcggcacagata
ctgacatctgaatgctcaaggcactgccggaatgggcactgcactcccacaggaaaatgc
tgctgtaatcaaggctgggaaggagagttctgcagaactgcaaagtgtgacccagcatgt
cgacatggaggtgtctgtgtaaggcctaataaatgcttatgtaaaaaaggctatcttggc
ccccagtgtgaacaagtggatagaaacatccgaagagttacaaggccaggtattcttgat
cagatcctagacatgacatcctacttgctggatctaaccagctatattgtatag

DBGET integrated database retrieval system