KEGG   Gallus gallus (chicken): 422518
Entry
422518            CDS       T01006                                 

Gene name
CCSER1
Definition
(RefSeq) serine-rich coiled-coil domain-containing protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Other DBs
NCBI-GeneID: 422518
NCBI-ProteinID: XP_004941092
CGNC: 51763
Position
4
AA seq 880 aa
MGDSGSRRSTLVSRLPIFRRSISRRHDSLPSSPSSASAVGVHTSSPSSTNSSSGSTGKRR
SIFRTPSISFHNKKGGEQKPDAASQNVNISNGAQPSLSTFQKLCLEEHIKSRGRHSVSFG
SSRSKKITRSLTDDFEKGKEPSANKNVFINCISSGKNEGDDSGFVEEQSRCSVKQSTRKL
LPKSFSSHYKFSKPVPQSQSVSSVPQTGCMLEIKSYVESEPVIAASPSPCSAEVTECMGS
ALQSPLLSADLTAVQTPSDFITLTEDSVSEVDALPSSGNGALLKEDFGHSVSTSQIIFNP
AAVPLKKTDYVGSTCQSASVSPASHASLCSVESNTLFKTSAAVQTKASLQANELCVTDAR
HKGEMNSAKLNIETFALQHKEELGLHSPAAKELSEDQLENTFSKHIRETIPVMEPKIIQY
SEPQSFRTQQGYETNHPNVDLANSFSPYREGRFMEKRLRSSSEGTAGSSRLIIKPKDGNA
EELHSLRKQRASSSSSKMNSMDVLNNLGSCELDEDDLMLDLEFLEEQHHHRAVGREDSYQ
SIVSCAAVVLTPTVDTRKKEQMLKPEASKQNLSLKLSKEVEQGEARYPRISQLAGSPSVE
WPFTGLEEGGGIESLPFRLMLQDCTAVKTLLLKMKRVLQESTDMSPASSTTSLPVSPLPE
EPLLFKDGIKDECSVLKLQLKERDELIAQLREELEKAQCLQKALASQADKSTQTELFGHD
ATYPNRMVSQNLSTRDKKSAHTPTEDPFRYSSNQATTYESKSCQLSNLCLSNILKEKEIV
EVIKHTRGAYEALTSEATQNGLATAAPSTAKPASQTDRYPLFSGAPKDHTAVPQQHTTFT
GRLGQPPRGPISLHMYSRKNVFLHHNLHTAELQTLGQQDG
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgggggactcaggatccaggcgatcaactctagtatctcggttgccaatattcaggaga
agtattagccggagacatgactccctcccttcctcgccttcctctgccagcgctgtgggt
gtgcacacctcctccccatccagcactaactccagctcagggagcacaggcaagcgccgg
agcatatttcgaactccttccattagcttccataacaagaaagggggggagcaaaagcct
gatgccgccagccagaatgttaacatctcaaatggtgcccagccttctctcagcactttt
caaaaactgtgcctggaggaacacattaaaagcagaggaaggcattcggttagctttggc
agctctcgcagcaaaaagataacaaggtctttgacggatgattttgaaaagggaaaggag
ccttcagctaataaaaatgtctttataaattgcataagctctggcaaaaatgagggtgac
gattctggctttgtggaggagcagagccgctgctctgtcaaacagtccacacgaaaactg
ctccctaaatctttctcatcacactacaagttttccaaaccggttccacagagtcaatca
gtttcctctgtgcctcagactgggtgcatgctggagataaaatcctacgttgaaagcgag
ccagtgattgctgcatccccttctccatgctcagctgaggtgacagagtgcatggggagt
gctttgcagtctccactgctctcagctgacctcacggctgtccagaccccctctgacttc
ataactttgacggaggattctgtttcggaggttgatgctctgcccagcagtgggaatgga
gcgttgcttaaagaggattttggccacagtgtctctacctctcagataatctttaatcct
gctgctgttccattgaagaaaacggattatgtgggaagtacttgccagtccgcttctgta
tctcctgcaagtcatgcaagcttgtgtagtgttgaatctaataccttgttcaaaacctca
gctgctgttcaaacaaaagcatcactgcaagccaatgaactttgtgttacagatgccagg
cataaaggagaaatgaactcagcaaagttgaatatagaaacctttgcgttacagcataaa
gaagaactggggttgcactcgccagcagcaaaggagttgagtgaggaccaattggaaaac
acgttctctaagcacataagagaaacaattcctgtaatggaacctaagattattcaatat
tctgaacctcagtcctttagaacacaacagggatatgaaacaaaccatcctaacgttgat
ctcgccaatagcttcagtccatatcgagaaggcagatttatggagaagcgactcagatcc
tcctcggaaggcactgctggaagcagtcgactgatcataaaaccaaaggatggcaatgca
gaagagcttcacagtctacggaagcagagagcaagctcatcctcttcaaaaatgaatagc
atggatgttttgaataacttgggttcctgtgagttagatgaagatgatctgatgcttgat
ttggagttcctagaagaacaacatcaccatcgtgctgttggtcgagaagactcgtaccag
tcaatagtctcatgtgctgctgtagtacttaccccaacagtggatacaaggaagaaagaa
cagatgctaaaacctgaagcgtctaaacagaacctctctttgaaactgtcgaaggaggta
gaacaaggagaagccaggtacccccgtattagccagctggctggcagcccatccgtggag
tggccttttactggtctggaagaaggcggaggcattgaatctttgcccttcagactgatg
ctgcaagattgcacagctgtaaagacattgctactgaaaatgaagagggttcttcaggag
agtacagacatgagtccagctagcagcaccacctcactccctgttagccctcttcctgaa
gagccattactttttaaggatggaataaaagatgaatgctcagtgctgaagctgcagctg
aaggagagagatgaactcatagcccaacttcgtgaggaactggaaaaggctcagtgtttg
cagaaggctcttgcttcccaggcagataaatccacacagacagaactttttggccatgat
gctacatatccaaacagaatggtgagccaaaatctcagcacaagggacaaaaagtcagca
catactcccaccgaggacccttttaggtactcaagcaaccaagcaacgacctatgaaagc
aagagctgtcaactgtctaatttgtgtctgagcaacatcctgaaagagaaggagatagtg
gaagtcatcaagcatactagaggagcctacgaagccctcacttcagaggccacccagaat
ggtttggccactgcagcaccaagcacagcaaagcctgcatctcagacagaccgctaccca
ctattctcaggagctccaaaagaccatactgctgtacctcagcagcacaccactttcaca
ggcagacttggacagcctccgaggggacccatctctttacacatgtacagcaggaaaaat
gttttccttcaccacaatttacacacagcagagctgcagactttaggtcaacaagatggg
tag

DBGET integrated database retrieval system