KEGG   Gallus gallus (chicken): 422593Help
Entry
422593            CDS       T01006                                 

Gene name
ARHGAP24
Definition
(RefSeq) rho GTPase-activating protein 24 isoform X1
  KO
K20642  Rho GTPase-activating protein 22/24/25
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    422593 (ARHGAP24)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    422593 (ARHGAP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH PH_11 FPP DUF3435 ATG16 ADIP
Motif
Other DBs
NCBI-GeneID: 422593
NCBI-ProteinID: XP_004941168
CGNC: 8447
Ensembl: ENSGALG00000011124
UniProt: A0A3Q2TW29
Position
4
AA seq 746 aa AA seqDB search
MDEHNGSAEMPSVSQGRHGTIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDEIKPL
GAIFLPGNRVIEHPCNEESPGKFLFEVVPGGDRERMTANHETYLLMASTQNDMEDWVKSI
RRVIWAPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA
NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYDDFLSCAKMLSK
EEEMGLIELLKQVKSLPAVNYNLLKYICRFLDEVQSYSGINKMSVQNLATVFGPNILRPK
VEDPLTIMEGTVVVQQLMSVMISKHEELFPKDADPEVGPEVCNNNNEMPKKAIVGQLQNK
ENNNTKETAVRRCSWDKPESPQRGSMDNESPTALPGSKTSSPRNSVQKLDVTRSPPLMVK
KNPAFNKGSGIVTNGSFSSSVESHEKSQTLPTCTLQARRTSSLKGAVTKMGTQSMQNGGV
RMGVSSTDGLTNTLSNRSPGWAPNGSVTLRDNKQKESVSESGQHNRLSTYDNVHQQFSTV
NSDDKQSVDSATWSTSSCEISLPEHSNSCRSSTTTCPEQDFFAGNFEDSVLDGPPQEDLS
NTGDYENKSDRRSVGGHSSRATSSSDNSETFVANSTNNHSALHSLVSSLKQEMAKQKLEY
ETRIKSLEQRNLTLETEMIALHEELDQERKKFTMVEIKMRNAERAKEDAEKRNDMLQKEM
EQFFSTFGELTVEPRRPERGNTIWIQ
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacacaacggctctgcagagatgccctcagtgagccaagggcggcacggcacc
atcaagtgtggatggctgcgaaagcaagggggcttcgtcaagacctggcacacacgctgg
tttgtcctcaaaggggaccagctttattattttaaagatgaagatgaaatcaagccactg
ggtgctatctttctgcctggcaacagagtaattgagcacccctgcaatgaagagagtcca
ggaaagttcctttttgaagttgtaccaggaggagaccgagagcggatgacagctaatcat
gagacgtatcttcttatggcaagcacgcagaatgacatggaggattgggtgaagtccatc
cgcagggttatatgggcaccgtttggaggaggtatttttggccagaagttagaagacact
gtccgatatgagaagcgatatgggaaccgcctggctcccatgctggtggagcagtgcgtg
gatttcatccgccagcgggggctgaaggaagaaggcctctttcgactgcctgggcaggct
aatcttgtcaaggagctccaggatgcatttgactgtggagagaaaccttcttttgacagc
aatacagatgtgcacacggtggcgtcgctgctgaagctgtacctaagggaactcccagag
ccagtcataccatatgcaaaatatgacgatttcctttcctgtgccaaaatgctcagcaag
gaagaagaaatgggcctgatagaattattgaagcaagtgaagagcctgccggctgtcaat
tataatctgctgaaatacatctgtagattcctggatgaagtccagtcttattcaggcata
aacaaaatgagcgtgcaaaatctggctactgtttttggccccaacattctccgccctaaa
gtggaagatcctttgactatcatggagggtacagtagtagtccagcagttaatgtcagtg
atgataagcaaacatgaagagctgtttcccaaggatgcagaccctgaggtgggacccgag
gtgtgcaacaataacaatgaaatgccaaagaaagcaattgttggacagctacaaaacaaa
gagaacaacaacaccaaggagacagcagtgaggcgctgctcttgggataaacctgagtct
ccccaaaggggaagtatggacaatgaatctccaactgcactgccaggcagcaagaccagt
agccccaggaacagtgtccagaaattagatgtcaccagaagcccaccactcatggtgaaa
aaaaatcctgcttttaataaaggcagcggcatagtcaccaatggatcattcagcagctct
gtggagagccatgagaagagccagaccttaccaacctgtaccctgcaagccaggagaaca
tcttccctgaaaggagcagtgactaagatgggcacacaaagcatgcagaatggaggtgtg
aggatgggagtttctagcaccgatgggctcaccaacaccctcagcaaccgaagcccgggc
tgggcacccaatggcagtgtcacgctgagggacaacaagcagaaggaatcagtgagtgag
tcgggtcagcacaacaggctctccacctatgacaatgtccaccagcagttctccacggtg
aactctgatgacaaacagagtgtggacagtgctacctggtcaacgtcctcctgtgaaata
tccctccctgagcattctaactcctgtcgttcatccaccaccacctgccccgagcaggac
ttctttgcgggtaactttgaagactctgtgctggatggaccaccacaggaagacctctct
aacacgggtgactatgagaacaaaagtgacagaaggagtgtggggggccacagcagcaga
gccaccagcagcagtgataacagtgaaacgttcgttgccaacagtactaacaatcatagc
gctttgcacagcctggtgtccagcttgaagcaagagatggccaaacaaaaactcgagtat
gagacaaggataaaaagcttggaacagagaaatctcaccctggagacagagatgatagcc
ctgcatgaagagctggatcaagagcggaagaaattcacaatggtagaaatcaaaatgcgt
aatgcagaacgggccaaagaggatgcagagaagaggaacgacatgctgcagaaggaaatg
gagcagtttttctctacttttggagaactgacagtggagcctcgccgaccagaaaggggc
aacaccatctggatccagtga

DBGET integrated database retrieval system