KEGG   Gallus gallus (chicken): 422599Help
Entry
422599            CDS       T01006                                 

Gene name
TMEM150C
Definition
(RefSeq) transmembrane protein 150C
  KO
K21846  transmembrane protein 150
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    422599 (TMEM150C)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    422599 (TMEM150C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frag1 DUF998
Motif
Other DBs
NCBI-GeneID: 422599
NCBI-ProteinID: XP_015131967
CGNC: 51782
Ensembl: ENSGALG00000011175
UniProt: A0A3Q2TW69
Position
4
AA seq 249 aa AA seqDB search
MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDNKIIALNVPERKPGSKRPPYISIAGD
APPASCVFSQVMNMAAFLALVVAVLRFIQLKPKVLNPWLNVSGLVALCLASFGMTLLGNF
QLSNDEEIHNVGTSLTFGFGTLACWIQSALTLKINLKNEGRKAGIPRVALSAGITLCVVL
YFILMAQGIHMYAARIQWGLVMCFLCYFGTFAVEFRHYRFEIVCSEYQENFLSFSESLSE
ASEYQTDQV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaagaaatgcagcgtgtggatgtttttgccccttgtgtttaccctatttacg
tcagctgggttatggattgtgtactttatagctgtggaagacaacaaaattattgcacta
aatgtaccggagaggaaaccaggttccaaaagaccaccttatataagtattgcaggtgat
gctcctcccgcgagctgcgtgtttagccaagtcatgaacatggcagcgtttctagcactt
gttgttgctgtcctgcgtttcattcagctgaagccaaaggtgctgaacccttggctgaac
gtcagcggcctggtggcgttgtgcctggcctcctttgggatgaccttactcggcaacttc
cagctttctaatgatgaggagatccacaatgtgggcacatcactgacctttggctttggg
accttggcatgctggattcagtctgctctcaccctcaagatcaacctgaagaatgaggga
cggaaagctgggattccacgagttgccttatcggccggcatcactctctgcgtggtgctt
tatttcatcctgatggcgcaaggcatccacatgtatgctgccaggatccagtggggcctg
gtgatgtgcttcctgtgctactttggcacgtttgccgtggagttcaggcactacagattt
gagatagtttgttctgagtaccaggaaaactttctgagcttttctgaaagcttgtcagaa
gcctccgagtaccagacggatcaggtgtag

DBGET integrated database retrieval system