KEGG   Gallus gallus (chicken): 422616
Entry
422616            CDS       T01006                                 

Gene name
ADGRL3
Definition
(RefSeq) adhesion G protein-coupled receptor L3 isoform X15
  KO
K04594  adhesion G protein-coupled receptor L3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    422616 (ADGRL3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    422616 (ADGRL3)
Peptidases and inhibitors [BR:gga01002]
 Mixed peptidases
  Family P2
   422616 (ADGRL3)
G protein-coupled receptors [BR:gga04030]
 Adhesion receptor family
  Latrophilin
   422616 (ADGRL3)
SSDB
Motif
Pfam: OLF 7tm_2 Latrophilin GAIN Gal_Lectin GPS HRM Dicty_CAR
Other DBs
NCBI-GeneID: 422616
NCBI-ProteinID: XP_004941205
CGNC: 8601
Ensembl: ENSGALG00000011319
Position
4
AA seq 1258 aa
MWSSQLLFFTMLLTPLAHAFSRAPVPMAVVRRELSCESYPIELRCPGTDVIMIESANYGR
TDDKICDSDPAQMENIRCYLPDAYKIMTQRCSNRTQCAVVAGPDVFPDPCPGTYKYLEVQ
YECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTD
TLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSG
EAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGT
WDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSMVDVPFPNS
YQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRAGQAHHGQVSYIAPPIHLDSDLE
RPPSKGVSTSGALGPVSTTTSTTPRMATSSTGRPTTTSALGRRNRSTSMPSPMADVPDEM
TTHLPPASSQLPPAGAESCDPMEARDIMWSRTRQGQVAKQPCPMGSIGVATFRCLAPDGI
WEPQGPDLSNCSSPWINHITQKMKSGEMAANIARELAEHTRNHLYAGDITYSVSAMVQLV
NLLDVQLRNLTPGGKDSAARSLNKLQKRERSCRAYVQAMVETVNNLLQPQALNAWRDLNA
SEQQRAATKLLDTVEDSAFVLADNLLKTDIVRENTDNIQLEVARLSTDGNLEDLKFPQNT
GHGSAIQLSANTLKQNGRNGEIRVAFVLYNNLGTYLSTENASMKLGTEAMSTNHSVIVNS
PVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYAKRTMTGYWSTQGCRL
LTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDLLLDFITWVGILLSLVCLLICIFTF
CFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMF
LEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTY
FIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGA
IALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLR
THCCSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSA
SLNRGAMANHLITNALLRPHGTNNPYNTLLGESAVYNNPSVSMYNAQGESVKGGGHGR
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgtggtcatcacagctgctgttcttcacaatgctcttaacaccgttagcccatgctttc
agccgtgccccggtccccatggctgtggtccgaagggaactgtcctgtgagagttacccc
atagagcttcgctgcccgggaacagatgttatcatgattgaaagtgccaactacgggagg
actgatgataaaatctgtgactctgatcctgctcagatggagaatatccgctgttatctg
ccagatgcctataagattatgactcaaagatgcagtaatcggacccaatgtgctgttgtg
gctggccctgatgtgtttccagacccttgccctgggacgtacaaatacctggaggttcag
tatgaatgtgtcccttacaaagtggagcaaaaagttttcctttgccctggactgctgaaa
ggagtataccagagcgaacacctgtttgaatccgaccaccagtctggtgcctggtgcaaa
gacccgctgcaggcatctgacaagatctactacatgccctggacgccttatcggacagac
acactgacggagtactcgtccaaggatgacttcatcgctgggaggccgaccacgacctac
aaactccctcaccgagtggacggcacagggtttgtggtgtacgacggggctttgttcttc
aacaaggagcgaacccgaaatatagtcaagtttgacttgcggacaaggataaaaagtggg
gaggctatcatagctaatgcaaattaccatgacacctctccctaccgctggggaggcaag
tctgatatagacctggccgtggatgagaatgggctatgggttatctatgcaacagaacaa
aataatggcaaaatagtcattagccagttaaacccttatacattaaggattgaagggacg
tgggatactgcctatgacaagaggtcagcttctaacgcttttatgatctgtgggatttta
tatgtggtcaagtctgtgtatgaagatgatgacaatgaagccacggggaataaaatagac
tacatatataacactgaccaaagcaaggatagcatggtggatgtgccctttccaaactcc
tatcagtacattgctgctgtggattataatccccgggacaaccttctttacgtatggaac
aactatcacgtagtgaagtattccttggattttggcccgctggacagcagagcagggcag
gctcaccatgggcaggtttcctatattgccccaccgatccacctcgattcggatctggag
cgaccgccatctaagggggtatcgacatcaggggcactgggcccagtgagcaccactacc
agcaccacgccacgaatggctaccagcagcactggtcgccccaccaccacctcggccttg
ggcaggaggaacaggagcaccagcatgccctcacccatggctgatgtccctgatgagatg
accacgcacctcccgcccgcctcctcccagctgcccccagctggtgccgagagctgcgac
ccaatggaagcccgtgatattatgtggtctcggacccggcagggacaggtggctaagcaa
ccatgtcccatgggctcgataggtgttgcaactttccggtgtcttgcaccagatggaatc
tgggagccccagggaccagatctcagcaactgctcttctccctggatcaaccacatcact
cagaagatgaagtcaggggagatggctgccaatattgcccgagagcttgcagagcacacc
agaaaccacttgtatgctggtgacatcacatactccgtgtctgccatggtccaactggtg
aacttgcttgatgtacagctccgaaacctgacgccaggtgggaaggacagtgctgcacgc
agcttgaataagcttcagaaaagggagcgctcttgcagggcctatgtccaggccatggtg
gagacggtgaacaaccttcttcagccacaggctctgaatgcctggagggacctgaacgca
agtgaacaacaacgtgcagccaccaaattgcttgacactgtggaggacagtgccttcgtg
ctggctgataacctgctgaagactgacattgtccgtgaaaacaccgacaatatccagctg
gaagttgcaagactaagcacagatggcaatctagaagatctgaagtttccccagaacacg
ggccatgggagcgccattcaactttcggcaaataccttgaaacaaaatggtcgaaatggt
gaaatcagggtggcctttgtgctttacaacaacttgggcacctatctctccacggagaat
gctagcatgaaattaggaaccgaagcgatgtctactaatcactccgtcatcgtcaactcc
cctgtcatcacggcagcaataaacaaagagttcagcaataaggtttatctagctgatccc
gtggtctttaccgtcaagcatatcaagcagtcagaagaaaatttcaatccaaactgttca
ttctggagctacgctaagcgtaccatgactgggtattggtccacccaaggatgtcgcctc
ctgacaactaacaagacgcacaccacatgctcctgcaatcacctaaccaactttgcggtc
ctgatggcacatgtagaagttaagcacagcgacgcagtgcatgacctgcttctggacttc
atcacctgggtgggcatcctgctgtcacttgtctgcctcctgatctgcatcttcaccttc
tgcttcttccgtgggctacagagtgaccgcaacacaattcacaagaacttgtgcataagc
ctcttcgtagcagaacttctctttctcattggcatcaaccggactgaccagccgattgct
tgtgctgtctttgctgccctcctgcacttcttcttcctggcggctttcacctggatgttc
ctggaaggtgtgcagctctacatcatgctggtggaggtttttgagagtgaacactcgcgg
aggaagtacttctatttggttggctatggcatgcctgcactgattgtggccgtgtcagca
gcagtggactaccggagctatggcacagacaaagtatgttggctccgacttgacacctac
ttcatttggagctttataggaccagcgaccttgataattatgcttaatgttatcttcctt
gggattgctctctataaaatgtttcatcatactgccatactgaaacctgaatctggatgt
cttgacaatatcaactatgaggataacagacccttcatcaagtcctgggtgataggtgcg
atagccctgctttgcctattaggactgacctgggcatttggactcatgtatattaatgaa
agcacagtcatcatggcgtatctcttcaccatattcaattctctgcagggaatgtttata
ttcattttccattgtgtcctccagaaaaaggtacgtaaagagtacggaaaatgcctgcgc
acacattgctgtagtgggaaaagtacagagagctccattggctcaggaaaaacctcgggg
tcacggacacctggaagatattccacaggctcacagagccggattcgtaggatgtggaac
gacacagttcgaaagcagtccgagtcttcctttattactggagatataaacagttcagct
tcactcaacagaggagccatggctaatcatcttataaccaatgctctgcttcgtcctcat
ggcactaacaacccttataatacattgctcggggaatcggcggtctataacaacccttct
gtcagcatgtacaacgcacaaggagagagtgtaaaaggaggaggacatggtaggtga

DBGET integrated database retrieval system