KEGG   Gallus gallus (chicken): 422618
Entry
422618            CDS       T01006                                 

Gene name
TECRL
Definition
(RefSeq) trans-2,3-enoyl-CoA reductase-like
  KO
K24219  trans-2,3-enoyl-CoA reductase-like [EC:1.3.1.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    422618 (TECRL)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     422618 (TECRL)
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 422618
NCBI-ProteinID: XP_420576
CGNC: 51789
Ensembl: ENSGALG00000038771
UniProt: A0A1D5P442
Position
4
AA seq 362 aa
MLRRRKTSASELKRDLSAHGGALSMSQNTRTFFNFSQLVLSAGHLKPPPVLKHSKVTYFE
VEILDVQSKKQICIVDKIPPSSTLLDVKHKFHKACPQWYPSRVGLQLERNGPYLKDSVNI
QSLAASSIITLYFTDLGQQVGWTTFFLTEYTGPLLIYLLFYIRLSTIYDQVESTKNFRHP
VVHLACFCHCLHYIRHLLETLFVHKFSGGHTPLKNMIKGCVFYWGFTSWIAYYINHPRYT
PPSFGHRQVSLAALAFLMCEAGNHFINVALAHQNHSGNKACFPSPTYNPFTWLFLLVSCP
NYTYEVGSWISFTVMTQTLPVGIFAFLMVIQMSLWAQKKHKLYLKKFYPEVRRKAAMIPI
VF
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgctcaggaggaggaagaccagcgcctcagaactcaagagggatctttcagctcatgga
ggagctctgtccatgtcacaaaacacacgcacttttttcaacttctctcagctggtgctt
tctgctggccatctcaaaccgccaccagtgctcaaacattcaaaagtcacttactttgaa
gtggagatccttgatgtgcaaagcaagaagcagatctgcattgtggacaagatacctcca
tcatctaccctcctagatgtgaaacacaaatttcacaaagcctgtccccagtggtaccct
tcccgtgttggtctgcaactggaacggaatgggccttatttgaaggattctgttaacatt
caaagcctagcagcgtcctccatcattacactgtattttacagacctgggtcagcaggtt
ggttggaccacattttttctaacagaatacactgggcctctactaatatacctgctcttt
tacattcgtctctcaactatttatgatcaagtggaaagtacgaagaacttccgccaccca
gtggttcacttggcctgcttctgtcattgtttgcactacatcagacatcttctggagaca
ttatttgttcacaagttttctggagggcacactcccctgaaaaatatgataaagggctgt
gtcttttactggggattcacttcttggattgcatactacatcaaccatccccgatatacg
ccaccatcatttggccacagacaagtttctcttgctgcccttgcttttctgatgtgtgaa
gctggaaatcactttatcaacgtagcattagctcaccaaaatcattcaggaaacaaagcc
tgttttccaagtccaacctacaaccccttcacgtggctcttcttgctggtatcctgtccc
aactatacttatgaggttgggtcttggattagtttcacggtaatgacacaaaccctgcca
gttggcatttttgctttcctgatggtcatccagatgtctctctgggcccaaaagaaacac
aagctgtacctgaagaaattttatccggaggtgcggagaaaagcagctatgattcctatt
gtcttctga

DBGET integrated database retrieval system