KEGG   Gallus gallus (chicken): 422621
Entry
422621            CDS       T01006                                 

Gene name
POLR2B
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB2
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    422621 (POLR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    422621 (POLR2B)
   03400 DNA repair and recombination proteins [BR:gga03400]
    422621 (POLR2B)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     422621 (POLR2B)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     422621 (POLR2B)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      422621 (POLR2B)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5 Amidoligase_2
Other DBs
NCBI-GeneID: 422621
NCBI-ProteinID: NP_001006448
CGNC: 8655
Ensembl: ENSGALG00000011387
UniProt: Q5ZMN9
Position
4
AA seq 1174 aa
MYDADEDMQYDEDDDEITPDLWQEARWIVISSYFDEEGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHATGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEDQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGYDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRFTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtacgacgcggacgaagatatgcaatacgatgaagacgacgacgagatcacccccgat
ctgtggcaggaggcgcgctggattgtcattagctcctattttgatgaagaaggtttagtc
agacaacagctggattcttttgacgagtttattcagatgtctgtgcagagaattgttgaa
gatgctccaccgattgatttacaagcagaagcccagcatgccacaggagaagtggaagaa
ccaccccggtatctcctgaagtttgaacaaatctatctctccaaacctacgcactgggaa
agagatggagcaccatcacctatgatgcccaatgaagccaggctgagaaaccttacgtat
tcagcccccttgtacgtggatataactaaaacagttattaaagaaggggaagatcagtta
cagacacaacatcagaaaacttttataggaaaaattcccattatgttacgatcaacgtac
tgtttgttaaatggcttaactgaccgtgacctttgtgaactgaatgaatgccctctggat
ccaggtggctattttatcattaatggatcagaaaaggttctgattgctcaagaaaaaatg
gctacaaacacagtatatgtgtttgcaaaaaaagattccaaatatgcctacacgggagag
tgtcgatcttgtctggagaattcctctcgaccaacaagtactatatgggttagcatgcta
gccagaggtgggcagggtgcaaagaagagtgctattggtcagcgcattgtagcaacgttg
ccatatatcaaacaagaagtgccaatcataatcgtcttccgtgccctagggtttgtgtct
gacagggacattttagagcacatcatttatgattttgaagatccagaaatgatggaaatg
gttaagccatccctggatgaagcctttgtgattcaggagcaaaatgttgctctgaacttc
attggatcaagaggtgcaaagccaggcgtcaccaaggaaaagagaatcaagtacgctaag
gaagtcctgcagaaagaaatgcttccacacgttggtgtcagtgacttctgtgaaaccaag
aaggcctatttcctagggtatatggttcatagattgttgttggctgcactgggcagaagg
gagcttgatgacagagatcattatggcaacaaaaggctggatcttgctgggccactgctg
gcttttctgttcagaggaatgtttaagaatttgctgaaggaagtgagaatatatgcacag
aagtttattgacagagggaaggatttcaacttggagctggcaattaaaacgagaattatt
tctgatggtttgaaatactcactggccactggaaactggggtgatcagaagaaagctcat
caggccagagcaggtgtatctcaggtgttaaaccgcctgacttttgcatcaacactttcc
cacctgagacgcctgaattctccaattggtagagatggaaagctagcaaagcccaggcag
ctgcacaatacgctgtggggaatggtttgcccagctgagactccagagggtcatgcagta
ggacttgtgaagaacttagccctgatggcttacatttctgtggggtctcagccatcccca
attctggaattcttggaagagtggagtatggaaaacctggaagaaatatctccagcggcg
atcgcagatgctaccaagatttttgttaatggctgctgggtaggaatacacaaagatcca
gagcagcttatgaataccctaaggaagctccgtcgtcagatggatatcattgtgtcagag
gtctcaatgattagggatattcgtgagcgagaaatccgcatctatactgatgcaggcaga
atttgccgacctcttctaattgtagaaaagcagaagttactgttgaagaaaaggcatatt
gaccaactgaaggaacgagagtataacaactacagttggcaggaccttgtggccagtggt
gtcgtagagtacatcgatacactggaagaagagactgtgatgctggccatgactccagat
gacttgcaggagaagggtgttgcatattgttcaacatatacccactgtgagattcaccca
tccatgatcctgggagtgtgtgcatctattattcctttccccgatcacaaccagtctcct
aggaacacataccagtctgctatgggtaaacaggcaatgggagtctacattacaaacttc
cacgttcgtatggacacgctggcccatgttctgtactatcctcagaagccccttgtaaca
acgcgctccatggagtacttgcgatttagagagttaccagcaggtatcaattcaatcgta
gccattgcgtcatatacaggctataaccaggaagattctgtcatcatgaaccgttctgct
gtcgacagaggctttttcaggtctgtgttctatcgctcctacaaagagcaagagtccaag
aaaggctatgaccaagaggaagtttttgagaagcctacccgtgagacttgccaaggtatg
agacatgcaatctatgacaaactggatgacgacggtttgattgcacctggggtacgtgtg
tctggggacgatgtcatcattggcaaaacagtaactctgccagaaaacgaagatgaactg
gaaagcactaacaggcgcttcactaagagagactgtagcacttttctgcgaactagcgag
actggcattgtagatcaggtcatggtaacccttaaccaggaaggatataagttctgcaag
atcagggtacggtctgtaagaatccctcaaataggagataaatttgccagcaggcatggt
cagaaaggaacctgtggtatccagtacaggcaagaggatatgcccttcacctgtgagggc
atcacaccagatatcatcatcaacccccacgccatcccttcccgcatgaccattggtcac
ttgattgaatgtcttcaggggaaggtgtcggcaaacaagggagaaattggtgatgctaca
ccatttaatgatgctgtcaatgtgcagaagatttccaatcttctatcagattatggctat
catttaagaggaaatgaggtcctctacaatggcttcactgggcgaaaaatcacatcacag
atcttcattggtcctacgtattatcagcggctgaagcacatggtagatgacaaaattcat
tctcgtgcaagagggcccatccagatacttaacagacagcccatggaaggtagatctcgt
gatggcggccttcgttttggagaaatggaacgggattgtcagattgcccatggagcagcc
cagttcttgagagagaggctgtttgaggcgtcagatccgtaccaagtccacgtatgtaac
ctgtgtggaatcatggcaattgcaaacacaaggactcacacgtatgaatgccggggatgc
cgaaataaaacacagatatctttggttcgaatgccctacgcctgcaaactcctcttccaa
gaactgatgtctatgagcattgcacctcggatgatgagtgtttag

DBGET integrated database retrieval system