KEGG   Gallus gallus (chicken): 422648Help
Entry
422648            CDS       T01006                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga00240  Pyrimidine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    422648 (DCK)
   00240 Pyrimidine metabolism
    422648 (DCK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     422648 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 DUF5066 AAA_17 Dynamin_N
Motif
Other DBs
NCBI-GeneID: 422648
NCBI-ProteinID: NP_001006451
CGNC: 66438
Ensembl: ENSGALG00000028501
UniProt: Q5ZMF3
Position
4
AA seq 257 aa AA seqDB search
MATPPKRGRLEGRVKKIAVEGNIAAGKSTFVNILKQADEGWEVVPEPVARWCNVQQNSEE
DCEELTTSQKSGGNVLQMMYEKPERWSFTFQMYACLSRIRAQLKSIDGKLREAENPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHKTLRTDFEYLQEIPILTLDVNEDFKGKK
DRYDHMTEKVKEFLSTL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccccccaagcgcgggcggctggagggcagggtgaagaagatcgccgtcgag
ggcaacatcgctgctgggaaatcaacgtttgtgaatattctcaaacaagctgatgaggga
tgggaagttgttcctgagcctgtagctagatggtgcaacgtccaacaaaactctgaagag
gattgtgaggaactgactacatcacagaagagtggtggaaatgtgcttcagatgatgtac
gagaaaccggagaggtggtctttcaccttccagatgtacgcgtgcctcagcaggattcgg
gctcagctcaaatccattgatggcaaactcagagaggcagagaatcctgtggtgttcttt
gagcgatctgtctatagtgacagatatatctttgcagctaatttatatgagtctgactgt
atgaatgaaactgagtggactatttaccaagactggcacgactggatgaataagcagttt
ggtcaaagccttgcactggatggaattatttatctcagagccactcctgagaaatgctta
aataggatttacttgcgtggaagagatgaagagcaagaaattcctattgagtatctggag
aagcttcactacaaacatgaaagctggcttcagcataagacactgcgaacagattttgaa
tatctacaagaaatacctattttaacattagatgttaatgaagacttcaaaggcaaaaag
gacagatatgatcacatgactgaaaaggtgaaggaatttttgagcacattataa

DBGET integrated database retrieval system