KEGG   Gallus gallus (chicken): 422688Help
Entry
422688            CDS       T01006                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04310  Wnt signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    422688 (CAMK2D)
   04310 Wnt signaling pathway
    422688 (CAMK2D)
   04020 Calcium signaling pathway
    422688 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    422688 (CAMK2D)
   04217 Necroptosis
    422688 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    422688 (CAMK2D)
   04916 Melanogenesis
    422688 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422688 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    422688 (CAMK2D)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     422688 (CAMK2D)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   422688 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Motif
Other DBs
NCBI-GeneID: 422688
NCBI-ProteinID: NP_001034389
CGNC: 9123
Ensembl: ENSGALG00000041635
UniProt: Q5ZKI0
Position
4
AA seq 479 aa AA seqDB search
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGTGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPINA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaccgccacctgcaccaggttcaccgacgagtaccagctcttcgaggagctc
gggaaaggggcgttctcggtcgtgaggagatgtatgaaaatcaccacaggacaggagtat
gctgccaaaatcatcaacaccaaaaagctctcagccagggatcaccagaaactggaaaga
gaagctagaatctgtcgtctcttgaagcatcctaatattgtgcggcttcatgacagcata
tcagaagaaggattccattacttagtctttgacttagtcactggaggtgaattgtttgaa
gatatagttgcaagagagtattacagtgaagcagatgccagtcattgtatacagcagatt
ctagaaagtgttaatcattgtcatctaaatggcatagttcacagagacctgaagcctgag
aacttacttttagctagcaaatccaagggagcagcagtaaaactggcagactttggattg
gctatagaagtccaaggggaacaacaggcttggtttggctttgctggcactccaggatac
ctttctccagaagttttacggaaagatccatatggaaaacctgtggatatgtgggcatgc
ggtgtcattctgtatatcctcctggtgggttatcctcctttctgggatgaagaccagcac
agactttaccagcagataaaggctggtgcttatgattttccctcaccagaatgggataca
gtgacccctgaagcaaaagaccttattaataaaatgcttaccatcaaccctgcaaaacgt
atcacagcttcagaagcactaaagcatccatggatctgtcaacgttccactgttgcctct
atgatgcacagacaggagacggtagattgcttgaagaaattcaacgcaagaagaaaacta
aagggggccattttgacaactatgctggctaccagaaatttctcagcagccaagagttta
ctgaaaaagccagatggagttaaggagtccacagagagttccaatacaaccattgaagat
gaagatgtgaaagctcgtaagcaggagattatcaaggttactgagcagttgattgaagct
atcaacaacggggactttgaagcttacacgaaaatctgtgatccaggccttacatccttt
gaacctgaagctttgggtaatctagtagaagggatggacttccatcggttttactttgaa
aatgctttatccaaaagtaataagccaatccacaccattatcctcaatcctcacgtccac
cttgtgggtgatgatgctgcttgcattgcatatatacggctcacgcagtacatggatgga
actgggatgccaaagacaatgcagtcagaggaaacgcgggtctggcaccgtcgtgacggg
aagtggcagaatgttcactttcaccgttcagggtcaccaacagtacctatcaatgcctag

DBGET integrated database retrieval system