KEGG   Gallus gallus (chicken): 422689
Entry
422689            CDS       T01006                                 

Gene name
ANK2
Definition
(RefSeq) ankyrin-2 isoform X8
  KO
K10380  ankyrin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    422689 (ANK2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    422689 (ANK2)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Other DBs
NCBI-GeneID: 422689
NCBI-ProteinID: XP_015131831
CGNC: 51804
Ensembl: ENSGALG00000012044
Position
4
AA seq 2665 aa
MGNAPICHACHSDKGMRTPGNIQDLDRIPDYYGCNCEESKEPEARSDSNASFLRAARAGN
LDKVVEYLKSGIDINTCNQNGLNALHLAAKEGHVGLVQELLERGSAVDSATKKGNTALHI
ASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIEVVKYLLENGANQSTATEDG
FTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK
MMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVK
LLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGD
HVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLH
IACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR
GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP
DAATTNGYTPLHISAREGQVDVASVLLEAGASHSMSTKKGFTPLHVAAKYGSLEVAKLLL
QRRASPDSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQ
IATTLLNYGAETNILTKQGVTPLHLASQGGHTDMVTLLLEKGSNIHVATKTGLTSLHLAA
QEDKVNVAEILTKHGANQDAQTKLGYTPLIVACHYGNIKMVNFLLKQGANVNAKTKNGYT
PLHQAAQQGHTHIINVLLQHGAKPNAITTNGNTALAIARRLGYISVVDTLKVVTEEITTT
TTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDG
MNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAMIDDTVVIPSQQVTTLAKEAERN
SYRLSWGPENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTR
VTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRI
LQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSENGDSWKEHFCEYTEDELNEILNG
MDEVLDTPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVF
PEGALTKRIRVGLQAQPMHTELIKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKAS
SDGIMNGYGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLID
CRQTQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQEN
FAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE
PCGRLSFMKEPKSTRGLVHQAICNLNITLPVYTKESESDQEQEEEVDMTSEKNDETESTE
TSILKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDPSDKTGSIKVKDLGKATEE
EPGEPFEIVERVKEDLEKVNEILRGGSYTKEEHALQKSLSRQEFVEEEWVIVSDEEIEEA
RRNAPVEVTEPICVEVRIDKETTEMEKKDMTGMVDYLTEDLNKYVSLHEVQPQALQEDIV
EERFEAVVISRDSEKEGRESPTTETLSPQEQHKPALEIKKPVRTKLRDKHKQKEGKMHSS
EQQPGLMKVSSDESPNEERGLTPAAAPEAKAVSPVIEETPIGSIKDKVKALQKRVEDEQK
IRSKLPVRIQTREGTAEKASKKPVPVKKSVAHKAQPPVSPSPKTERLEETMSVRELMKAF
QSGQDPSKNVSGLFEHKSVKQKQQPPEKETTRRKTISSQSETKRVSSHKTDKQKDKQSTV
LKAEKEPQPKKGRMQVSTVDTIKKTVGKDQVKQQSSKKTTVEPPPPVSADESTKDSAVVK
GKTSDDQGDTDFQISPDRKTSTDFSDVIKEELEDNDKYQQFRHLSVTEEGELNLEQVLTS
PFNVAFPAEYVKDGFLPALSLQSAAFDGSSESLKHEGVADSPGSLLDGTPQISSEESYKH
EGLAETPETSPESLSFSPKKTDGQIEEAKGTARVHTTAETCSPKELSPKENEKDQQDDRE
RTEERLAHIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH
ATDTSLTQCLTKINRMDIVHLMETSGIDSMQVHGTRTYTEIEQTIGLDHSEGFSVLQEEL
YSSRHKPDERHRISKDGDPTEHPPIVSEEDVSVSYSPFQDSTPRSEAELSMAELLRQTHK
EQVEAEFSGKPQDVIETTSSQHEYFVTTPGTEQRAASDTSARFSATKEEREKTSPQSPSS
AQRGGSPIIQEPEELHLHQDDPSPRRTSLVIVESIDEQPEKLGSGYEEESLEKELAEELG
ELENSSDEDEMVTTRVVRRRVIIQADSMPEMPPETVTEEQYTDEHGHTVVKKVTRKIIRR
YVSPDGTEKEDIIMQGTPQKPVTVEEGDGYSKVVKRVVLKSDSEQSEVTLSEPGVLPSAS
NFQSEPVEGRKVSKVIKTTVVQGERMEKHLGDASLATDLPSAKEDFEEALSYTGNQIKIQ
LPALVEKEIMKEDGSIIKRFGLAWQ
NT seq 7998 nt   +upstreamnt  +downstreamnt
atgggcaatgcacccatttgccacgcgtgtcactcagacaagggcatgaggactccaggg
aacatacaggacttggatagaatccctgactattacggatgcaactgcgaagaaagtaaa
gaacctgaagcccgctctgacagcaatgcaagctttctccgagctgccagggctggcaat
ttggacaaagtagtggaatacctgaaaagcggaatagacattaacacatgtaatcagaat
gggctcaatgctctgcacctggcggctaaagaaggccatgtgggactggtacaagaatta
ctggaaagagggtcggctgtggattctgccactaagaaagggaataccgccctacacatt
gcatccttagcaggacaagctgaagttgtcaaagttttggttaaggaaggagccaatatt
aatgcacagtctcagaatggtttcactccattatatatggcagctcaagagaatcatatt
gaagtggtgaaatatctcctggagaatggagccaaccaaagcacagctactgaggatggt
ttcactcctttagctgttgctttgcaacaaggacacaatcaagcagtggctatcctgctg
gaaaatgacaccaaggggaaagtgagattaccagctttgcacattgctgccagaaaagat
gacaccaaatcagcagcgctcctactgcagaacgaccacaatgccgatgtgcagtccaag
atgatggtgaataggacgactgagagtggctttacacctttgcacatagctgcgcattat
ggaaatgtcaatgtggcaacacttctgctaaaccgaggagctgcggttgatttcacagca
aggaatggaatcaccccactgcatgtcgcttccaaaaggggaaacacaaacatggtgaag
ctcttgttggatcgtggagggcagatcgatgccaaaaccagggatgggctcacaccactc
cactgtgctgcaagaagtggacatgaccaagttgtggagctgcttctggaacgaggtgcc
ccactgctcgcaaggaccaagaatgggctctccccacttcacatggcggcccagggggac
catgtggaatgtgtcaaacatctcctgcagcacaaagctcctgtggatgatgtcacgctg
gattacctgactgccctccatgtggctgcgcactgcggccactatcgtgtcaccaagctc
ctcctggacaagagagcaaatcccaatgctcgtgccctgaatggttttactccactgcac
attgcctgcaagaaaaatcgcatcaaagtcatggaactcctggtgaaatatggggcttca
atccaggctataacagagtcgggcctcacaccaatacatgtggctgcatttatgggccac
ttgaacatagtcctccttctgctgcagaatggagcctctcccgatgtcactaacattcgt
ggagaaactgcactgcacatggcagcacgtgccggacaggtggaagtagttcgttgtctc
ctgagaaatggggctctagttgatgcccgagccagggaagaacagactccactgcacatt
gcctctcgcttgggtaaaacagagattgtccagcttctgctacagcacatggcccaccct
gatgctgcaacaactaatggatacactccactgcacatctctgccagagagggacaagtt
gatgttgcatcagttctcctagaggcaggtgcctcacactccatgtccaccaaaaaggga
ttcacaccgttgcacgtggcggccaaatatgggagcctggaagtggcaaagctcctcctg
cagcgtcgtgcctctcctgactcagctggcaagaacggcctcacgcccctgcacgtggcg
gcccattacgacaaccagaaggtggcgctgctgctgctggagaagggcgcctcgccccac
gcgaccgccaagaatggatacacccctctacacattgctgccaagaaaaatcagatgcag
atagctaccacgctgttgaactatggggccgagaccaacattttgaccaaacagggagtg
acgccacttcatttagcctcccaggggggtcacacagacatggtgacattgcttttggag
aaaggatccaatatccatgtggcaacaaagactggactgacatccttacaccttgcagct
caagaggataaagtgaacgtagctgaaatactcacaaaacatggtgcaaatcaagatgct
cagacaaagcttggttatacacctttaattgtggcctgtcactatggaaacatcaaaatg
gtgaattttcttctcaagcagggagcaaatgtcaatgctaaaacaaagaatgggtacact
cctctccaccaagctgctcaacaaggtcacactcacatcattaatgtccttctccaacat
ggagctaagcccaatgccatcaccaccaatggtaacactgccttagctattgctaggcgt
ctgggatatatctcagtggtcgatacgctgaaggttgtaacggaggagattactaccacc
acaactactgtaacagagaagcacaagctaaatgtacccgaaacaatgactgaggtcctg
gatgtttcagatgaagaaggtgatgatacaatgacaggagatggaggagagtaccttagg
ccagaagacctcaaagaactaggagatgactctttaccaagcagccagttcttagatggt
atgaactacctgaggtacagcttggaaggagggcgatctgacagcctgcgatccttcagt
tcagacaggtctcacacactgagccatgcctcctacctgagggacagtgccatgattgac
gacactgttgtaatccctagccagcaggtaactactctggccaaagaagcagaaaggaat
tcatatcgcttaagctgggggcctgaaaacttggacaatgtggctctttcttccagccct
attcactcaggcttcctagttagtttcatggtggatgctcgtgggggtgccatgagaggc
tgcagacataacggactgcggattattattcctccacggaaatgcactgctccaacacga
gtgacttgccgcttggtgaaacgtcacagactggccaccatgcctcccatggtggaagga
gaaggcctggccagccgtctgatcgaagtgggaccatctggggcccagtttcttggtaaa
cttcatctgcctacggctcctcccccacttaatgagggagaaagcttggtcagccgaatc
cttcagctggggcctcctgggaccaaattccttgggcctgtgattgtggagattccccat
tttgctgctctgcgtgggaaagagagagaactggtgatcctgcgcagtgagaacggggac
agctggaaggaacatttctgcgaatacactgaggatgaactaaatgaaatcttgaatggg
atggatgaagtacttgacacaccagaagagcttgagaagaaacgtatctgccgcatcatc
actcgtgatttccctcagtactttgcagtggtgtcccgaatcaaacaggacagcaacctt
attggacctgagggaggtgtgctgagcagcactgttgtaccacaagtgcaggcagtcttc
ccagaaggggctttaaccaaacgaattcgtgttggcctccaggctcaacctatgcatact
gaacttataaagaagattttgggcaacaaggctaccttcagtcctatagtcacactggag
cccaggaggaggaagttccataaacccattacaatgacaattcctgtccccaaggcctcc
agtgatgggatcatgaatggttatggaggtgacacacccactttaaggttactatgcagc
ataacaggaggaaccacccctgcccaatgggaagacatcactggaacaacaccattgacg
tttgttaatgaatgtgtttccttcacaacaaatgtgtctgccagattttggttaattgac
tgccgacagacacaagaatctgttacttttgcttctcaagtgtatagagagattatctgt
gtcccctacatggccaaatttgtggtgtttgccaaatcacatgatcccattgaagcacgg
ttaagatgtttttgcatgacagacgacaaggtggataaaactctagaacaacaagaaaat
tttgctgaagttgccagaagcagggatgttgaggtattagaaggaaaacccatctatgtt
gactgttttggcaatttggtgccactaactaagagtggacaacatcatatattcagtttt
tttgccttcaaagaaaatagacttcctctatttgttaaggtgcgagataccactcaagaa
ccctgcggacgattatcattcatgaaggagccaaaatcaacaagaggtcttgttcatcaa
gccatatgtaatttaaacatcacattacctgtttacacaaaggaatcggaatcagatcaa
gaacaagaagaagaggttgatatgacttcagaaaaaaatgatgagacagaatctacagaa
acatctatcctgaaaagccatctggttaatgaagtccctgtactagccagtccagattta
ctgtctgaagtttctgagatgaaacaagatttgatcaaaatgactgccatcttgacaact
gacccttctgataaaacaggctctattaaagtgaaagatcttggaaaagccactgaagag
gagccaggagagccttttgaaatagttgaaagggtgaaagaagacttagaaaaagtgaat
gaaattcttagaggtggatcatatactaaagaagaacatgctttgcaaaagtctctttcc
agacaggaatttgtagaagaagaatgggtcattgtcagtgatgaagaaattgaagaggcc
agaagaaatgctcctgtagaagtcactgaacctatctgtgtagaagttagaatagacaaa
gagacaacagagatggaaaagaaagacatgacaggaatggtagattaccttactgaggat
ttaaacaaatacgtttctcttcatgaggtacagccacaagctttacaagaagacatagta
gaagagagatttgaagctgtagtaataagcagggattctgaaaaagaaggacgagagtct
ccaacaaccgaaacactaagtccacaagaacaacataagccagccttagaaattaaaaag
ccagttagaacaaagttaagagacaagcacaaacaaaaggaaggcaagatgcatagcagt
gaacaacaaccaggactaatgaaggtcagttcagatgagtctccaaatgaggaacgtggc
ttaacaccagcagctgctcctgaggctaaagctgtatcccctgtcatagaggagactcct
attggctcaataaaagataaggttaaagctcttcagaaacgagtggaagatgaacaaaaa
atacgctctaaactacctgtcagaattcaaacaagagaaggcactgctgaaaaggcttct
aaaaaaccagtaccagtcaaaaaatcagttgcacacaaagcacagcctcctgtttcacct
tctcctaagacagaaagacttgaagagaccatgtcagttcgtgagctgatgaaagccttc
cagtcaggtcaagacccatccaagaatgtatctggattgtttgagcacaagtctgtcaaa
caaaagcaacaaccccctgagaaggaaacaacacggagaaaaacaatttcttcacaaagt
gaaacaaaacgagtatcaagccacaagacagacaaacagaaggacaagcaaagcacagta
ttaaaagcagagaaagagccacagccaaagaaaggaagaatgcaagtgtccactgttgat
actatcaagaaaactgttggcaaagaccaagtaaaacaacagagcagcaaaaaaacaaca
gttgaacctccccctccagtatctgctgatgaaagtaccaaagattcagcagttgtaaag
ggcaagacttctgatgaccaaggtgatacagactttcagatcagccctgacaggaaaacc
tcaacagatttttctgatgtcattaaagaagaacttgaagacaatgacaaataccaacaa
tttcgacatctttcagtgacagaggaaggtgagcttaacttggagcaagtactgaccagt
cccttcaatgttgctttccctgctgagtatgtaaaagatggattccttcctgctctttct
ctgcaaagtgctgcttttgatgggagctcagagagccttaaacatgaaggtgtggctgat
tctccaggtagcctgcttgatggaactcctcagatcagttctgaggaaagttataaacat
gagggtctggcagaaactccagaaacaagccctgaaagcctttctttctcaccaaagaaa
actgatgggcaaattgaagaagctaaaggaacagctagagtacacacaacagcagaaaca
tgttctccgaaggaactctcaccaaaggaaaatgaaaaagatcaacaggatgatcgggaa
cggactgaggaaagactggcccacattgctgatcaccttggattcagttggacagagtta
gcaagagaactggatttcacagaagagcaaattcatcaaatcaggattgaaaatcctaat
tcacttcaagaccagagccatgcactcctcaaatactggcttgaaagggatgggaaacac
gcaacagatacaagtcttactcaatgtcttacaaaaatcaatcgaatggatattgttcac
ctaatggagaccagtggcattgactctatgcaggtccacggcactcgcacatatacagaa
attgaacaaacaataggattggaccatagtgaagggttttctgtactgcaagaagaactg
tacagttcaagacataagccagatgaacgccacagaatatctaaagacggtgacccaaca
gaacaccctcccattgtttctgaggaagatgtatctgttagttattctccttttcaggac
agtactcctaggagtgaggcagagctatcaatggctgagctcctaaggcaaacacacaag
gaacaagtggaagctgaattctcagggaaaccccaagatgtgatagaaacaacatcttca
caacatgaatattttgtcacaactccaggaacagagcagagggcagcaagcgatacatct
gcacgcttcagtgcaacaaaggaagagagagaaaaaacatccccacagtccccatcatct
gctcagagaggtggttctcccatcatccaagagcctgaagagctccatctccatcaggat
gatccgtctccaaggagaactagtctagtgatagtggagtcaattgatgaacagccagaa
aagcttggaagcggctatgaggaggaatctttagaaaaggagttagcagaggagttaggt
gagctggaaaacagctcggatgaggacgagatggtaactaccagagttgttcgtcgccgg
gtgattattcaggccgatagtatgcctgaaatgccaccagaaacagtcacagaagaacaa
tacacagatgaacatggccacacagtggtgaagaaggtcactagaaagatcatccggcga
tacgtttctccagatggcactgaaaaagaagatatcattatgcaaggaacaccacaaaaa
cctgtcacagttgaagaaggagacggctattccaaagttgtaaaacgagtcgtgctgaag
agtgacagtgaacagtcagaggtgactttgtctgaacctggtgttttgcccagtgcctcc
aatttccagtctgagccagtggaaggccgcaaggtcagcaaagtcataaaaactactgta
gtgcaaggagagagaatggagaaacacctgggggatgctagcttagctactgatcttccg
tcggccaaagaggactttgaagaggctttgagctatacaggcaaccaaattaaaatccaa
ctccctgcattagtagagaaggagatcatgaaggaggatggatcaattattaaaaggttt
ggcttggcatggcagtga

DBGET integrated database retrieval system