KEGG   Gallus gallus (chicken): 422758Help
Entry
422758            CDS       T01006                                 

Gene name
USP46
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 46 isoform X1
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     422758 (USP46)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   422758 (USP46)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    422758 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 DUF3399
Motif
Other DBs
NCBI-GeneID: 422758
NCBI-ProteinID: XP_004936086
CGNC: 10438
Ensembl: ENSGALG00000037496
Position
4
AA seq 381 aa AA seqDB search
MWCPSMPCAGNATHTIQLPWRTEPASGGTNASALEKDIGPEQFPINEHYFGLVNFGNTCY
CNSVLQALYFCRPFRENVLSYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISR
LRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEAEENNKQEL
TWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQ
KYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNT
SGDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYG
LTSDISKNSESGYILFYQSRE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgccccagcatgccttgtgctggcaatgccacacataccattcagctgccctgg
agaacggagcctgcctccgggggcaccaatgcctctgctctggaaaaagacattggccca
gagcagtttcccatcaatgaacactacttcggattggtcaattttgggaacacctgctac
tgtaactccgtgctgcaggcattgtacttttgccggccatttcgggaaaatgtgttatca
tacaaggcccaacagaaaaagaaggaaaatctcttgacttgcctggcagatcttttccac
agtattgctactcagaagaagaaagtcggagttattccaccaaagaagttcatatcaagg
ttacgaaaagagaatgatctctttgacaactacatgcagcaggatgcacatgagttttta
aattacttgctgaatacaatcgccgacattttgcaggaggagaagaaacaggaaaagcaa
aatgggaaactgaaaaatggcaacatgaacgaagctgaagagaacaataagcaagaactc
acctgggtgcatgagatttttcagggaacactgactaacgaaactagatgtttgaactgt
gaaactgttagtagcaaagatgaagattttcttgacctttctgttgatgtggagcagaac
acatcaattacacactgtctaagagacttcagtaacacagagacattatgtagtgagcag
aaatactactgtgaaacctgctgcagtaagcaagaggcacagaaaaggatgcgagtaaaa
aagctaccaatgattcttgccttacacctcaagagattcaagtacatggagcaattgcac
aggtatactaagctgtcttatcgtgtagtatttcccctggaattacgtctcttcaatacg
tctggtgatgctgtcaacttagaccggatgtacgacttagtagctgttgttgttcactgt
ggaagtggaccgaatcgtgggcattatattactattgtgaaaagtcatggattttggctc
ttgtttgatgatgacattgtagagaaaatagatgctcaagctattgaagaattttatgga
ctgacctctgatatatcaaaaaattcagagtctggttatattttattctaccagtcaaga
gagtga

DBGET integrated database retrieval system