KEGG   Gallus gallus (chicken): 422813
Entry
422813            CDS       T01006                                 

Gene name
DHX15
Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
  KO
K12820  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [EC:3.6.4.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    422813 (DHX15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    422813 (DHX15)
   03009 Ribosome biogenesis [BR:gga03009]
    422813 (DHX15)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     422813 (DHX15)
Spliceosome [BR:gga03041]
 Complex A
  U2 snRNP components
   U2 related factors
    422813 (DHX15)
 Complex B
    422813 (DHX15)
 Complex C
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-SnRNP related factors
    422813 (DHX15)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  90S particles
   Helicases
    422813 (DHX15)
SSDB
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_19 AAA_22 SRP54 Atrophin-1 AAA_25 AAA_30 Flavi_DEAD AAA_29 Apis_Csd AAA_23
Other DBs
NCBI-GeneID: 422813
NCBI-ProteinID: NP_001026330
CGNC: 10712
Ensembl: ENSGALG00000014395
UniProt: Q5F3A9
Position
4
AA seq 762 aa
MSKRHRLDLGDDYSSSKKRSDGKDRDRDRDRDDRKDRDRDRDRDRDRDREREKEKELRAA
SNSTLIAAGLPPMKPAMIPHSINPFTNLPHTPRYYDILKKRLQLPVWEYKERFTDILIRH
QSFVLVGETGSGKTTQIPQWCVDYMRSLPGPKRGIACTQPRRVAAMSVAQRVADEMDVML
GQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILM
GVLKEVVRQRADLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLE
AAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREIDDLGPEVGDIKIIPLYSTLP
PQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRV
ESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQ
LKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAK
MVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLKVYHA
FKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKAL
VTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDI
KPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgtccaagcgccaccgcttagatctgggcgacgattacagctccagcaagaagcgctct
gacgggaaggatcgtgaccgagacagggaccgtgatgaccggaaagatcgtgacagggat
cgtgacagagatagagatcgtgacagagaaagggagaaggaaaaggagttgcgagctgca
tctaactctacgctcattgctgctgggttaccacctatgaaaccagcaatgattccacac
agtattaaccctttcacaaatctaccacatacgcctcgttattatgacatactgaagaaa
cgactacagcttcctgtctgggaatataaagaaagattcacggatattttgattaggcat
cagtcatttgtgctggttggagagactgggtctggtaaaacaacacagatccctcagtgg
tgtgttgactacatgcgctcattgcctggaccaaagaggggaatagcatgtacccagccg
aggagagtggctgcaatgagtgtggcgcagagggttgctgatgagatggatgtaatgctg
ggccaggaggttggttactccattcgatttgaagactgcagtagtgcaaaaactattctc
aagtatatgactgatggtatgttacttcgtgaagcaatgaatgatcctttgctggagcgc
tatggcgttataattcttgatgaggcccatgagagaacactggctacggatattttaatg
ggagttttgaaagaagttgtaagacagagagctgatctgaaggttatagttatgagtgct
actttagatgctggcaagtttcagatctactttgataactgccctctactaactattccg
ggtcgcacccatcctgtggagatattctatactccagaaccagaaagggattaccttgag
gctgccattcgaacagtgatccagattcacatgtgtgaagaggaagaaggagatcttcta
ctctttcttactggacaggaggagattgatgaagcctgcaagaggataaaacgtgaaatt
gatgacttaggtcctgaagtgggtgacatcaaaatcattccattgtattctacccttcct
cctcagcaacaacagaggatttttgaacctcccccaccaaaaaaacaaaacggagcaata
ggaagaaaggttgttgtgtccactaacattgctgagacgtcattaacaatagatggtgtt
gtgtttgtgattgatcctggctttgcaaaacaaaaggtatataatcctcgtatcagagtg
gagtctctcttggtgactgcaattagtaaagcttctgctcagcagcgagctggccgtgct
ggtcgtactagaccaggcaagtgcttcaggctgtacacagagaaggcttacaaaactgaa
atgcaggataacacataccctgagattttgaggtctaacttaggatctgtagtgttgcag
ctcaagaagcttggtatagatgatttggtgcactttgattttatggatcctccagctcct
gaaactctcatgagagccttagagctcttgaattatctggctgctttaaatgatgatgga
gacttgacggagttggggtccatgatggctgaatttccactggacccacaactggctaaa
atggttattgcaagttgtgactacaactgctctaacgaggtcctatctattactgccatg
ttgtcagtcccacagtgttttgttcgtcccacggaagcaaagaaagcagcagatgaagcc
aagatgaggtttgcccacattgatggagatcatttgacgttgctgaaagtctaccatgct
ttcaaacaaaatcatgagtcggttcagtggtgctatgacaacttcattaactacaggtcc
ctgatgtctgcagacaatgtacgccagcagctgtcacgaatcatggatagatttaatttg
cctcgtagaagcacagattttaccagccgagactattacatcaatataagaaaggcatta
gttactgggtatttcatgcaggtggcgcacttggaacgaacagggcattacttaacagta
aaagataaccaagtggtacagttgcatccttccactgttcttgatcacaaaccggaatgg
gtgctttataatgagtttgtccttacaacgaagaactacatccggacatgtacagacatc
aaacctgaatggctggtgaaaattgcccctcaatattatgacatgagcaattttccacag
tgtgaagcaaagagacagttggatcgcatcattgccaaacttcagtccaaggaatactca
cagtactga

DBGET integrated database retrieval system