KEGG   Gallus gallus (chicken): 422830Help
Entry
422830            CDS       T01006                                 

Gene name
CC2D2A
Definition
(RefSeq) coiled-coil and C2 domain-containing protein 2A isoform X1
  KO
K19352  coiled-coil and C2 domain-containing protein 2A
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    422830 (CC2D2A)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    422830 (CC2D2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5523 CC2D2AN-C2 C2 DUF3987
Motif
Other DBs
NCBI-GeneID: 422830
NCBI-ProteinID: XP_015141286
CGNC: 10788
Ensembl: ENSGALG00000014514
UniProt: A0A3Q2U9Q1
Position
4
AA seq 1548 aa AA seqDB search
MATAPAAAAPPAPRSLPPVPSTSRMGFSELSVRERMREKLKAARSKAEATLSQEDLGPRP
RHLKSIRERKAELRLDKGSGDQLGELQRDESLLSSKIKFSDSVKKLKQKSQAQSDYPSAE
EAYNFFTLNFDPEPESIKAGARKRSELNEEEAEEYVETHEEEQEEDETDEDAHLVKDADL
FIMGQTDEDFLVTKPAECERYSEQLQKEKEFLFIPSMQTVPTSQKMPENMQPRYLEDEGL
YAEERPFVSPSNQNILENRILRQEKGKEWFGDDGRILALPNPIKQSSTRPPVFSLEEGIA
PELETIYRKAIRTTAANQYLIGPGDFQGPFQLDIDISGLIFTHHPCFSREHVLAAKLAQL
YDQYLARKQKNLTELLTDKLRALRNAVQCSMDSAAASGPTAQQSIPEYKIEIRQTRRLRD
AEQEKDRMLLKSIIKVWKQMKSLREFQKFTNTPMKLYLRKEEVDQRSDEKAYEAEIQAEI
NELQEEYMEEYEKKMEEYKTELQEWKSWKKAQKSKKKKKKDLREEESVEDYDVGEEPVKP
VPPKMVDSLEIEQQVREKANNFRRKPGEPALIPELVLSGSITPSEQCPRAEVLRREDVNK
RSAFIKVFFNSKEVSRTVTRPLSSDFRVHFGQIFNLQIFNWPESLKLQIYETTGMSSTTL
LAEVFIPVPETTVLTGSAPMEEIEFSSNQRVMLDHEGVGSDVSFSFEADGSNQMTLMTSG
KVSNSVSWAVGEKGIPLVPPVSQQNTGIPSALKNIDAIASIGTSGLTDMKKLAKWAAETR
LDPNDPNNAALMQMIMVASSGEAHVPDFFRLEQLQQEFNFVSDEEFNRSKRFRLLQLRNE
EVAEFRNYKQVPLHEREISEKLFQEYEKRLHERDVIDSKHYLDARRAVVANYLQKVRESV
INRFLIAKHHFLLSDLVNEEEIPTLGILGLGLFKLAEPKRPLKPRRKERKKVTAQSLSDG
DIKLLVNIIRAYDIPVRKPVTSKLQQPSKSSRSFNEMFAASPSAQSPTNNVDWAFDQVLV
RPFVEVSFQRTVCRTTTAEGPNPNWNEELEFPFRAPNGDYSTHSLQSVKDEVFINVFDEV
LHDVTEDDRDRGSGIHTRIERRWLGCVKIPFTTIYFQARIDGTFKVNIPPVLLGYSKEKN
LGIERGYDSVRNLSEGSYITLFITIEPQLIPGESVREKMNEMLKKFDTQEDEKLLQAAEK
YEAECTSKFPSRQCLTTVIDLSGKTVFITRYIKPLNPPQELLDALPNSSQTTAELVARYV
ALIPFLPDSVSFAGICDLWCTSDQFLDLLAGDEEEHAVLLCNYFLGMGKKAWLIIGNAIP
EGQTAYVLTLEQSQYVIWNPSTGCFYRQYDTFCPLQSVYCLISCDNIWFNIQQWDSPVRI
SFDISKPKLWKPFFSRSLPYPGLCSVQPEELVYQHSDKAAAVELQGRIEKILKEKIMEWR
PRHLTRWNRYCTSTLRNFLPLLEQNQGKDVEDDHQAELQKQLGDYRVSGFPIHMPFSEVR
PLVEAVHSTGVHTIDVSNVEFALAVYVHPYPQNVLSTWIYVASLVRNR
NT seq 4647 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagccccggcggctgctgcccctccggcgccgcgcagcttgccccctgtgcct
tctacatcaagaatgggattttcagaactttccgtcagggagcgtatgagagagaaactg
aaagcagccaggtcaaaagcagaagctactttatctcaagaagacctgggtccacggcca
aggcatttaaaaagcatcagagaaaggaaagcagaactgagactggataaagggtctggt
gatcaacttggagagttgcaaagggatgaatctctcttatcatcaaaaataaagttttct
gattctgtgaaaaaactcaagcagaagtcacaggcccagagtgattatccttctgctgaa
gaagcgtataacttctttaccttaaattttgatcctgaaccagagagtataaaggctgga
gcacggaaaaggagtgaattaaatgaagaagaggcagaagaatacgtagaaacccatgag
gaagaacaagaggaggatgaaacggatgaagatgcacacctagttaaagatgctgatttg
ttcattatgggacagacagatgaagattttctagtaacgaagcctgctgagtgtgaaaga
tactctgaacagctgcaaaaagaaaaagaattcctgttcattcccagcatgcaaacagtg
cctacttctcagaagatgcctgaaaacatgcagcctaggtaccttgaggatgagggtctt
tacgcagaagaaaggccatttgtatcaccatctaatcaaaatattttagaaaacagaatt
ctaagacaggagaaggggaaagagtggtttggtgatgatggcagaatcttagcattgcct
aatccaattaaacagtcttctactaggcctccagtattctcattggaagaaggcattgca
ccagaacttgaaacaatctatagaaaggcaataagaacaacagctgccaatcagtatctc
attggacctggagattttcaggggccgtttcaactggatattgatatttctggactaata
ttcacacatcatccctgttttagccgtgaacatgtgttagcagctaaactggctcagtta
tatgatcagtatttagccagaaaacagaagaatcttactgaacttctcacagacaagctg
cgtgctttgaggaacgctgtgcaatgtagcatggacagtgctgctgcttctggtcctaca
gcacaacagagcatacctgaatacaaaattgaaatcaggcaaaccagaagacttcgtgat
gctgaacaagaaaaagataggatgttgcttaaaagtattataaaagtttggaaacaaatg
aagtccctccgtgaatttcagaagttcactaacacgcccatgaagctttatttgaggaag
gaagaagttgatcagagatcagatgagaaagcatatgaagcagaaattcaggctgagata
aatgaattacaagaagaatacatggaagaatatgaaaagaaaatggaggagtataaaact
gagctacaagagtggaaatcctggaagaaggcacagaagtccaaaaagaaaaagaagaaa
gaccttcgagaagaagaatcagtagaagattatgatgttggtgaagaacctgtaaagcca
gtcccacctaaaatggtcgatagcctggaaatagagcagcaggttagagaaaaagctaac
aacttcagaaggaaacctggagagcctgctttaattcctgaactagtcttgtcaggaagc
ataactccaagtgagcagtgtcctcgggcagaggttttacgacgagaagacgtaaacaaa
cgctctgcatttataaaagtctttttcaactccaaagaagtatcaaggactgttactcga
ccactaagttcagatttcagagttcactttggacagattttcaatttacaaattttcaac
tggccagagagtttgaagctacagatctatgaaacaacgggcatgagcagtaccaccttg
ctggctgaagttttcatacctgttcctgagacgacagttctgacaggcagcgctcccatg
gaggagatagagttcagcagcaatcagcgtgtgatgctggaccatgaaggagttgggagt
gatgtatccttttcatttgaagctgatggtagcaatcaaatgactttaatgacttctggg
aaggtatctaatagtgtttcttgggcagttggagagaaaggaatccccctggttcctcca
gtatctcagcaaaacacaggaattccaagtgctttaaaaaatatcgatgctattgcatcc
attggcacatcaggcttaactgacatgaagaaactggctaagtgggcagcagaaactaga
cttgatccgaatgacccaaacaatgcagctctgatgcagatgattatggttgccagtagt
ggagaggcacatgttcctgacttcttcagactggaacagttgcagcaagagtttaatttt
gtttctgatgaagaatttaatagatcaaagagattccgactcctgcagctcaggaatgag
gaggtggcagagttccgaaactataagcaagtccctttgcatgaacgagaaatcagtgag
aaacttttccaggaatatgagaaaagactacacgagagggatgtgattgacagtaagcat
tacctggatgcgcgcagagctgttgttgccaactatctacaaaaggttcgagaatcagta
attaaccgtttcctaatagcaaagcaccatttccttctctctgacctggtcaatgaagag
gagattccaactctgggcattttgggactcggcctctttaaactggcagagccaaaacgg
ccgttaaagccaagaagaaaggaaaggaagaaggtcacagcacagagtttatcagatgga
gacatcaagctgttagtgaacatcattagagcttatgacattccagtaagaaaaccagtc
acaagcaaacttcaacagccatccaaatcttcgagatcctttaatgagatgtttgcagcc
tctccatctgctcagagcccaaccaacaatgtagattgggcatttgaccaggttttagtc
cgtccatttgtagaagtttcttttcagcgaacagtctgtcgaacaacaacagcagaaggt
ccaaaccccaactggaatgaggaacttgagtttccatttagagctcctaatggtgactac
agcacccatagtttgcagtcagtgaaggatgaagtgttcattaatgtttttgatgaagta
cttcatgatgttacagaggatgatcgtgacagaggaagtggtatccacactcgtatcgag
cggcgctggctgggatgtgttaagattccctttactacaatatattttcaggctaggatt
gatggtacattcaaggtgaatattcctccggtactccttggctacagcaaagagaagaac
ctgggcattgagagagggtatgattctgtgcgaaacctgagtgagggctcctatataaca
ctgttcattaccattgaaccacagctcattcctggagagtcggtcagggagaagatgaat
gaaatgcttaagaagtttgatacccaagaagatgagaaattgcttcaagcagcagaaaaa
tatgaagctgaatgtacgtcgaagtttccaagccgtcagtgcctaacaacggtaattgac
ctcagtggaaaaacagtttttattaccagatacatcaaacccctcaatccgccccaggag
ctcctcgatgccctcccaaacagctctcagacaacagcagaattggtggctcgatatgtt
gctttgattccattcttgccagatagtgtgtcatttgctggaatttgtgacctgtggtgt
acatcagatcaatttcttgatcttctggcgggggatgaggaagaacatgccgtgctcctg
tgtaattattttcttggtatggggaagaaagcctggctaatcattggaaatgctattcct
gagggacaaactgcgtatgtgttaactttggagcaaagtcagtatgtgatttggaatccc
agcactggctgcttttacaggcagtacgatactttctgccccttgcaaagcgtgtactgt
ctgatcagctgcgataacatttggtttaatatccaacagtgggactctccagtaaggata
agttttgatatcagcaaaccaaaactttggaagcctttcttttcaagaagcttaccatac
cctgggctctgcagtgttcagcctgaagaattggtgtatcagcattcagacaaagctgct
gcagtggaactacagggcaggattgaaaaaatactgaaggagaaaattatggaatggaga
ccaaggcatttaactcgctggaacagatactgtacctctaccctacgtaacttcttgcct
ctgctggaacaaaaccaaggcaaagatgtagaagatgaccatcaggcagagctgcaaaag
cagctgggagattacagggtgtctggatttcctattcatatgccattttctgaagtcaga
cctttagtagaagctgtacacagcactggagttcataccattgatgtttccaatgttgaa
tttgccctagctgtgtacgttcatccttatccccaaaatgttctctccacatggatttac
gttgcttcacttgtacggaatcggtag

DBGET integrated database retrieval system