KEGG   Gallus gallus (chicken): 422847
Entry
422847            CDS       T01006                                 

Gene name
ZBTB49
Definition
(RefSeq) zinc finger and BTB domain-containing protein 49
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 BTB zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met GAGA zf-C2H2_11 zf-C2H2_3rep Zn-ribbon_8 zf-C2HC_2 zf-H2C2_5
Other DBs
NCBI-GeneID: 422847
NCBI-ProteinID: XP_004936225
CGNC: 11155
UniProt: A0A3Q2UG42
Position
4
AA seq 764 aa
MDTVASHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRTLFQNSSGQ
KNDVFHLDIKNVGGIGQILDFMYTSHLDLSQDNVQAMLDIAQCLQVQNVLNICHTFLKSS
SAIEQTTNMPCNSVFSLQNSLTADTSCTNDSYGTNLLQECPSDTQANKVLADHHSHASQS
VNLHTPSGDLQKQSHNSLDGNCTELPFKQPNYYYKLRNFYSKQFYKQNACSNNERVAEQS
FSYNTSTEINTVQSNSCPVSHPECILETSEHLPSNFLAQPLNEAAPDQDAESMLLQPTKQ
MRLKKAVHLKKLNFLRSQKSAEQPPEPKGDDSRITRVNESANESTMGVTNVRVAEEKEAD
DSVNSENFEQTVEIERSQGPLEQEGQSQTLQSQRQYTCELCGKAFKHPSNLELHKRSHTG
EKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPH
LCDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSA
CGKCFAGSGDLRRHVRTHTGEKPYTCETCNKCFTRSAVLRRHKKMHCKATDEGPNTLDEF
TQGIETSDLDKSQSSDSFGQEMSVTLLPVSVKFPVRSTANSTEFGSSTDSYCKLRSMIQH
HDSANQQKLNVDSAKLPKAQTQQAPPPPYAYADVDGSSAEETLESDNISMIRSSMVSLDG
HCNDPLGNRTSSVAYKNTEGPFFSSMTLWGLAMKTLQNESELEQ
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggacactgttgctagccatagttgtcatctactccagcagctacacgagcaacgcatt
cagggtcttctctgtgactgtatgttggtggtgaaaggtgtctgcttcaaagcacacaaa
aatgtgttagctgcttttagtcaatacttcaggaccctttttcagaattcttcaggccag
aagaatgatgtctttcatttggacataaaaaatgtaggtgggataggccagatcttggac
ttcatgtatacctcccatctggatcttagtcaggataatgtacaagctatgttggatatt
gcacagtgtcttcaagtgcaaaatgtgctgaatatttgccacacctttttaaaatcttct
tcagccatagagcaaacaaccaatatgccttgtaatagtgtattttccctgcagaatagt
ttgactgcagatactagttgtaccaatgacagttatggaacaaacttattacaagagtgt
ccatccgacacacaagctaacaaagtcttggctgaccaccattctcatgcatcacagtct
gttaatcttcacacaccctcaggtgatttacagaagcagtcacacaactccttagatggc
aactgcacagaacttccattcaaacaaccaaattactattataaattgcgcaacttttac
agcaaacagttctataagcaaaatgcttgctctaataatgagagggtagcagaacagtcc
ttttcttacaacacgtctacagaaataaacacagtacagagtaattcttgtcctgtcagt
caccctgaatgtattctggaaacctctgaacatttaccatcaaactttctggctcagcct
ttgaatgaagccgctccagatcaagatgcagaaagcatgctgttgcagcccaccaaacag
atgaggctgaaaaaggcagtacacctcaaaaagttgaattttctaagatctcagaaatct
gcagagcagcccccggagcctaaaggagatgacagtaggataacacgagtaaacgaatct
gcaaatgaaagtaccatgggtgtgacgaatgtcagagttgctgaagaaaaagaagctgat
gactcagtgaattctgagaattttgaacaaactgttgaaattgaaagatctcaaggtcct
ttggaacaagaaggacagtcacagactcttcagtcacagaggcaatatacttgtgaatta
tgtgggaaggctttcaaacatccaagcaatctggagctgcataaaaggtcccatacaggt
gaaaaaccttttgaatgtaacatttgtgggaaacacttctcacaggcaggtaatctccag
actcatttacgtcgacattctggtgaaaagccttacatttgtgagatctgtgggaaaaga
tttgctgcttctggtgatgttcagcgtcacattattattcattctggagaaaagcctcat
ctgtgtgatatctgtggcagaggattcagtaacttcagtaatttgaaggagcataaaaag
actcatacggcagataaagtgttcacctgtgatgaatgtgggaagtcattcaacatgcaa
cgaaaattagtaaagcacagaattagacatactggggagagaccatacagctgttcagca
tgtgggaaatgttttgcaggctctggtgacctgcgcagacatgtgcggacgcatacagga
gaaaagccctatacctgtgaaacttgtaacaagtgcttcactcgttctgctgttttacgg
cggcacaagaaaatgcattgcaaagccactgatgaaggtccaaacacactagatgaattt
actcaagggattgaaacttctgatcttgacaaatctcagagctctgactcttttggccaa
gaaatgtctgttacgttgttaccagtgtcagttaaatttcccgttcgttcaactgcgaat
tcaactgaatttggcagttctacagattcttactgtaagctgcgatcaatgattcaacac
catgactcagcaaaccaacagaaattgaatgtggattcagctaaactcccgaaagctcag
acacagcaagctccaccaccaccatatgcttatgcagatgtagatggatcttctgcagaa
gaaacattagagtctgataatatttccatgattcgttcctctatggttagtctggatggt
cactgtaatgatccactaggcaatcgaacatcatctgttgcatacaagaatactgaagga
ccattcttctccagcatgaccctctggggtttagctatgaagactttgcagaatgaaagt
gaactggaacagtga

DBGET integrated database retrieval system