KEGG   Gallus gallus (chicken): 423041
Entry
423041            CDS       T01006                                 

Gene name
AMPD3
Definition
(RefSeq) AMP deaminase 3
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    423041 (AMPD3)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     423041 (AMPD3)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 423041
NCBI-ProteinID: NP_001186517
CGNC: 4219
Ensembl: ENSGALG00000005662
UniProt: F1NG97
Position
5
AA seq 765 aa
MPRQFPKLNISEDDVQVRLQAEKVFATVLREEDSKDALSLFTVPEDCPIGQTEAKERELQ
KELAEQQSVETAKRKKSFKMIRSQSLSLQIPSQEWKAPSAIPTVSPTTPVLQSAFLPVQV
PYDVPEFQRVSISGDYCAGVTVDDYEQAAKRLVKALLIREKYSRLAYHRFPRTTSQYLCS
MQHEKWKVEDEVCPYFHSPPEENEDPYNLDDAPDNLDYVVKIKGGIPFVYDNKEMMELNE
PRSLPYPDLETYTLDLSHVLALIADGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKS
NPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTESDRIVAEKKGKKMTLKQVFESL
HMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYIGGEYFARMVK
EVALELEESKYQYTEPRLSIYGRSPDEWQNLAKWFIKHKVYSPNMRWIIQVPRIYDIFRS
KNILPNFGKMLENVFVPLFEATINPKDHKELHLFLKYVTGFDSVDDESKHSGHMFSEKSL
NPDLWTSEKNPPYSYYLYYMYVNIMLLNNLRQERGMCTFLFRPHCGEAGSITHLVSAFLT
ADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLST
DDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSDKEKQKFLGVNYCKE
GPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMRTDEISTLSK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgcccagacagttcccaaagctgaacatatctgaagatgatgtgcaagtgcgacttcaa
gcagagaaggtatttgctacagttctccgagaagaagacagcaaagatgccttgtcacta
ttcactgtgcctgaagactgccctattgggcagacagaggccaaggaaagggaactgcag
aaggaactggcagaacaacagtctgtggaaacagcaaaaaggaagaaaagtttcaagatg
attcgatctcagtctttgtcattacaaattccatctcaggaatggaaagcaccatcagcc
attcctactgtgtctcctacaacaccagttcttcaaagtgctttcctgccagtccaggtg
ccatatgatgtaccggagtttcagagagtttcaattagcggggactactgtgcaggggtt
acagttgatgattatgagcaagctgccaagaggctggtgaaagctcttctcattcgagaa
aagtattcacgccttgcataccatcgcttcccaagaacgacatcccagtatctgtgtagc
atgcaacatgaaaaatggaaggttgaagatgaagtatgtccatattttcattcaccccca
gaagaaaatgaagatccttacaatcttgatgatgctccagacaatttggattatgttgtc
aagataaaaggtggcattccgtttgtttatgataacaaagaaatgatggagctcaatgag
cctcggagtctgccctatcctgacctggagacctatacccttgacttgagccacgttctt
gctctaattgcagatggtccaacaaagacatactgccatcgccggctgaactttttagaa
tctaaatttagtttgcacgagatgttaaatgaaatgtctgagtttaaagaactgaagagt
aatccccatcgggacttttataatgtgaggaaggttgatactcatatccatgctgctgct
tgcatgaaccagaaacacttactgaggtttattaagcacacgtatcaaacggagtcagac
aggattgttgcagagaaaaaaggcaagaagatgaccttaaagcaggtctttgaaagcctt
cacatggatccatatgacctcactgtggactctttagatgtccatgcaggtcgtcaaaca
tttcatcgatttgacaaattcaattccaagtacaatccagttggtgccagtgagctgagg
gacctgtatttgaaaactgagaactacattggtggtgaatattttgctcgtatggtcaag
gaagtagcccttgaactagaagaaagtaagtaccagtacacagaaccccgattatccatc
tatggacgctctccagatgaatggcagaacttggcaaaatggttcattaaacataaagtc
tattcccctaacatgcgctggataattcaggttcccagaatctatgatatatttaggtca
aagaatattctgccaaattttggaaagatgttagagaatgtttttgtgcctttgtttgaa
gcaacaatcaatcccaaagaccacaaagaattacatcttttcctcaaatatgtgactggc
tttgacagtgttgatgatgaatccaaacatagtggccatatgttctctgaaaaaagcctt
aacccagacctctggaccagcgagaagaatcccccgtatagctattatttgtattacatg
tatgtcaacatcatgttgctaaacaaccttaggcaggaaagaggcatgtgtactttcttg
tttcgacctcactgtggagaagctgggtctatcacacatcttgtgtcagcctttctgaca
gcagacaacatttctcatggactgctcttgaagaagagtcctgtcctgcagtatctttat
tatcttgcacaaatacccattgccatgtctccacttagtaacaatagcctattcctggag
tactcaaaaaatccactacgggaatttctccataagggacttcacgtctctctctctaca
gacgatcctatgcaatttcattacacaaaggaagcactcatggaagaatatgctattgca
gcccaggtgtggaaactaagtacctgtgacttatgtgagatagcaagaaacagcgtgcta
cagagtggattgtcagataaggaaaaacagaaattcttaggggttaactactgtaaagaa
gggccagagggaaatgacattcgtaagacgaatgttgcacagatccggatggccttcagg
tacgagacgctgtgcaatgaacttagtttcctgtctgatgctatgagaacagatgagatt
tcgacgttgtcaaagtag

DBGET integrated database retrieval system