KEGG   Gallus gallus (chicken): 423111
Entry
423111            CDS       T01006                                 

Gene name
RNH1
Definition
(RefSeq) ribonuclease inhibitor
  KO
K16634  ribonuclease inhibitor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    423111 (RNH1)
SSDB
Motif
Pfam: LRR_6 LRR_RI_capping LRR_4
Other DBs
NCBI-GeneID: 423111
NCBI-ProteinID: NP_001006473
CGNC: 5211
Ensembl: ENSGALG00000006904
UniProt: Q5ZIY8
Structure
PDB: 
4PER

Position
5
AA seq 456 aa
MDLDIQCEEMNPSRWAELLSTMKSCSTIRLDDCNLSSSNCKDLSSIIHTNPSLKELKLNN
NELGDAGIEYLCKGLLTPSCSLQKLWLQNCNLTSASCETLRSVLSAQPSLTELHVGDNKL
GTAGVKVLCQGLMNPNCKLQKLQLEYCELTADIVEALNAALQAKPTLKELSLSNNTLGDT
AVKQLCRGLVEASCDLELLHLENCGITSDSCRDISAVLSSKPSLLDLAVGDNKIGDTGLA
LLCQGLLHPNCKIQKLWLWDCDLTSASCKDLSRVFSTKETLLEVSLIDNNLRDSGMEMLC
QALKDPKAHLQELWVRECGLTAACCKAVSSVLSVNKHLQVLHIGENKLGNAGVEILCEGL
LHPNCNIHSLWLGNCDITAACCATLANVMVTKQNLTELDLSYNTLEDEGVMKLCEAVRNP
NCKMQQLILYDIFWGPEVDDELKALEEARPDVKIIS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaccttgacatccagtgtgaggagatgaacccgtcgaggtgggctgagcttctgtcc
accatgaagtcctgcagcaccatcaggctggatgactgcaatctctccagcagtaactgc
aaggatctctcctcaatcatccatacgaatccatccctcaaagagctgaagctgaacaac
aatgagctgggggatgcaggcatcgagtacctgtgtaaaggcttgctgactccaagctgt
agtttgcagaagttatggttgcagaactgcaacctgaccagtgccagctgcgagactctc
cgctccgtcctcagtgcacagccatcactgacagagctgcatgtgggcgataacaaactg
gggactgctggggtgaaggtgctgtgccaagggctgatgaaccccaactgtaagctgcag
aagctgcagctggagtattgtgagctcactgctgatatcgtggaggctctcaatgctgcc
ctgcaagccaagcccaccctgaaggagctcagcctgagtaacaacacgctgggagataca
gctgtgaagcagctgtgccgggggctggtggaggcgagctgcgacttggagttactacac
ctggagaactgtgggataaccagcgacagctgtcgggatatcagcgcggttctcagcagc
aagccctctctgctggatctggctgtgggggataacaagatcggggacaccgggctggcc
ctcctgtgccaaggactgttacatcccaactgcaagatccagaagctatggttatgggac
tgcgacctcacaagtgctagctgtaaagatctctctagagtcttcagtacaaaagagacc
ctcctggaggtcagtctgatagacaacaacctgagggactccggaatggaaatgctgtgt
caggcgctcaaggatcccaaagctcacctccaggagctatgggttagagagtgcgggctc
acggctgcttgctgcaaggcagtcagctctgttctaagcgtgaacaaacacttgcaagtc
ctgcacatcggtgagaacaagctgggcaatgccggggtggagatcctgtgtgaggggctg
ctgcaccccaactgcaacatccactctctgtggctgggcaactgcgatatcacagcagcc
tgctgtgccacgcttgctaacgtcatggtcaccaagcagaaccttacagagctggacctg
agctacaacactttggaggatgaaggtgtgatgaagctctgtgaagctgtgaggaacccc
aactgcaagatgcagcagctgattctgtacgacattttctggggtcctgaagtggatgat
gaactaaaagccctggaagaggccaggcctgatgtgaagatcatttcatga

DBGET integrated database retrieval system