KEGG   Gallus gallus (chicken): 423132
Entry
423132            CDS       T01006                                 

Symbol
SERPING1
Name
(RefSeq) plasma protease C1 inhibitor isoform X1
  KO
K04001  C1 inhibitor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    423132 (SERPING1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    423132 (SERPING1)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I4: serpin family
   423132 (SERPING1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   423132 (SERPING1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 423132
NCBI-ProteinID: XP_025006934
CGNC: 5576
Ensembl: ENSGALG00000007381
Position
5
AA seq 532 aa
MSGAVMPGAAAAGWDVPGPPSPGEAGLLTMKLCLLLVCLVAMVTATVTPVPTPETTPSGR
VKPIRLQPAQTVFPRLWDTGTPTQPVPSSNASTTEEPSLGAVLEALEPLGPVEFVAAPEE
SGTAANGSVATPEPETTTGPPSTPPGTINPPCPGDEEPAETCWAPTREQKEEVAMALGTF
ALRFYQHMAESAKPDTNLLFSPVNVALGLSHLLLGARGETQQRLAAILGYQPGLACVHSA
LQQLVNVSGLLSATEIFHHPDLHLRPRFLNESWRFYKARPRELSGNESLDLQRINEWVRK
ATHGLVPQLLSQLPDEPRLVLLSAVHFQARWQKPFKTKHTVLLPFMRHGHRPVDVLTMTS
KKYPVASFTDPRLQVQVGRLELSGGLSLVVLVPRGPPEALEAVERALDPPTFLALLQRAA
NTPVRPTTVALPRLHLDLAVDVVAKVHDMDFGLFLDAELCGLAQGPEVAVDAAQHRAVLT
LDEKGVEAAGAMATSLARIALQLEALQPFLFVLWDEGNAIPLFMGRLSDPQA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtccggtgcagtgatgcccggtgccgccgctgctgggtgggacgtcccggggccgccc
tctccgggagaggcggggttgctcaccatgaagctctgcctgctgctggtgtgcctggtg
gccatggtcacggccactgtcaccccggtgcccacgccagagaccactccttccggaagg
gtgaagcctatcagactgcagccagcacagacggtgttcccacgtctgtgggacacgggg
acaccaacccagcctgtgcccagctccaatgccagcaccacggaggaacccagcctgggt
gccgtgttggaggccttggagcctctgggccctgtggaatttgtggcagcacccgaggag
tctggaaccgccgccaacgggagcgtggccacacctgagcctgagaccaccacgggtccc
cccagcacccctccaggcacaataaatccaccgtgccctggggacgaggagccggccgag
acctgctgggcaccaacgagggagcagaaggaggaggtggccatggcgctgggcaccttc
gccctacgcttctaccagcacatggcagagtctgccaaacccgacaccaacctgctcttc
tcccccgtcaacgtggccctggggctgtcacacctcctgctgggtgcccgcggtgagacc
cagcagcgcctggctgccatcctggggtaccagccagggctggcctgcgtgcacagcgcc
ctgcagcagcttgtcaatgtgtcagggctgctctccgccacagagatcttccaccaccca
gacctgcacctccgaccccgcttcctgaatgagtcgtggcgcttctacaaagcccggcca
cgggagctgagtggtaacgagagcctggacttgcaacgcatcaatgagtgggtgcgcaag
gccacacatgggcttgtgccccagctgctgtcccagctgcctgatgagcctcgcctggtg
ctgctcagcgctgtccacttccaggcccggtggcaaaagccattcaagaccaagcatacg
gtgctgctgcccttcatgcgccacgggcaccggccagtggacgtgctcacgatgaccagc
aagaagtatcccgtggcctccttcactgacccccgcctgcaggttcaggtggggcggctg
gagctgagtggggggctgagcctggtggtactcgtgccgcggggacccccggaggcactg
gaggctgtggagcgagcgctggacccccccaccttcctggcactgctgcagcgggcagcc
aacacccccgtgcgccctactaccgtggccctgccacgcctgcacctcgacctcgccgtg
gacgtggtggccaaggtgcacgacatggactttgggctgttcctggatgcggagctgtgt
gggctggcacagggcccagaggtggcagtggacgcagcgcaacaccgggctgtgctgacg
ctggacgagaaaggcgtggaggcagcgggtgccatggccacctcattggcccgcatagct
ctgcagctggaggctttgcagcccttcctcttcgtgctctgggatgaaggcaatgccatc
cctctcttcatgggacgccttagtgacccccaggcctga

DBGET integrated database retrieval system