KEGG   Gallus gallus (chicken): 423174
Entry
423174            CDS       T01006                                 

Gene name
PRDM11
Definition
(RefSeq) PR domain-containing protein 11 isoform X3
  KO
K24644  PR domain zinc finger protein 11 [EC:2.1.1.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    423174 (PRDM11)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     423174 (PRDM11)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    423174 (PRDM11)
SSDB
Motif
Pfam: DUF4371 Dimer_Tnp_hAT SET
Other DBs
NCBI-GeneID: 423174
NCBI-ProteinID: XP_004941616
CGNC: 6095
Ensembl: ENSGALG00000008053
Position
5
AA seq 1013 aa
MDCFAKQIYSPSGYVIISREEREQNLMAFQHSERIYFRACRDIRPGEKLRVWYSEDYMKR
LHSMSQETINRNLTTGDKKLQKEKSEKNADNQEDTRAPLHFTTLKQGKSPYKRSYDEGES
HPQTKKKKIDLIFKDVLEASLESAKFEEKQLATSTPLSTRATSKYQAEEIFERCSSAMQH
GSLNLSRNRSEEEWKAPHGSSFSSAKEVGVLEDEEEEPLSLKADSPTELSLASAEGNSHE
IPTTSFCPNCIRLKKKIRELQAELDMLRSGKLPEPPVLPPQVPELQEFSDPTASESIISV
PTIMEDDDQEVDSADESVSNEMIAATDEPSKMSSATGRRIRRFKQEWLKKFWFLRYSPTL
NEMWCHVCRQYTVQSSRTSAFIIGSKQFKIHTIKLHSQSNLHKKCLQLYKLRMHPEKTEE
MCRNMTLLFNTAYHLALEGRPYYDFRPLAELLRKCELKVVDQYMNEGDCQILIHHIARAL
REDLVERIRQSPFLSIILDGQSDDVLADTVAVYVQYTSSDGPPATEFLSLQELGFSTTDS
YLQALDRAFSSLGIRLQDEKPTIGLGVDGANITASLRANLFMTIRKTLPWLLCLPFMVHR
PHLEILDAISGKELPCLEELENNLKQLLSFYRYSPRLMCELRVTASTLCEETEFLGDIRA
VKWIIGEQNVLNALIKDYLEVVAHLKDVSGQTQRADASAIALALLQFLMDYQSIKLIYFL
LDVIAVLSRLAYVFQGEYLLVSQVDDKIEEAIQEISRLADSPGEYLQEFEENFRESFNGI
AVKNLRVAEAKFQSIREKICQKTQVILAQRFDSRSRTFVKACQVFDLAAWPRSTDELMSY
GKEDMVQIFEHLETVPSFSREVCREGMDTQGSLLMEWRELKVDYYTKNGFKDLLSHICKY
KQRFPLLNKIVQILKVLPTSSACCEKGRNALQRVRKNNRSRLTLEQLSDLLTIAVNGPPI
ANFDCKRALDSWFEEKSGNSYALSAEMLSRMSSLDQKPMLQSVDHGSEFYPDI
NT seq 3042 nt   +upstreamnt  +downstreamnt
atggattgctttgcaaagcagatctactcaccctctgggtacgtgatcatatcccgggag
gagagggagcagaacctgatggccttccagcacagtgaaaggatttacttccgtgcctgt
cgtgacatccggcctggggagaagctgcgggtctggtacagtgaggattacatgaagcgg
ctgcatagcatgtcccaggagaccatcaacagaaatctcacaacaggagacaaaaaatta
cagaaggaaaagtcagaaaagaatgcagataatcaagaggacacaagggctccactccac
ttcaccacattaaagcaagggaagagcccctacaaacgcagctatgacgagggggagtcc
cacccccaaacaaagaaaaaaaagattgacctcatcttcaaagatgtcctggaggcctct
ttggagtctgccaaatttgaagagaaacagttagcaacaagtacaccgctttccacaaga
gcaacatctaaataccaggcagaagagatctttgagaggtgcagtagtgccatgcagcat
ggctccctaaatctcagcagaaacagaagcgaagaggagtggaaggcccctcatggttcc
tctttcagttctgccaaagaagtgggagtccttgaagacgaggaagaagagcctctgtct
ctgaaagcagacagccctaccgagctgtcactggcttctgcagaaggcaactcccatgaa
attcctaccacctccttctgccccaattgcatccggttgaagaagaaaatcagagagcta
caggctgagttagacatgctgagatctgggaagttacctgagccacctgtgctaccaccc
caggtacctgagctccaagagttctcagaccccacagcttcagagagtatcatctctgtt
cccaccatcatggaggatgacgatcaggaggtggattctgctgatgaatcagtttccaat
gaaatgattgctgctacagatgagccttccaagatgtcttctgcaacgggacggagaata
cggaggtttaagcaagagtggcttaagaagttttggtttctgcggtactccccgacattg
aatgaaatgtggtgccatgtctgtaggcaatacacagtgcaatcctctcggacttcagct
ttcatcattggctcaaagcagttcaagatacacacaataaaacttcatagccagagcaac
ctccacaagaagtgcctgcagctttacaagctcagaatgcacccagagaagacagaagag
atgtgtcgaaatatgactttactcttcaatacagcctaccacttggcactggagggcagg
ccctactatgactttcggcctctggcagagctattgagaaagtgtgaactcaaggtggtg
gatcaatacatgaatgaaggagactgccaaatcttaatccaccatattgcccgggctctt
cgggaggaccttgttgaacgcatccgacagtcacccttcctcagcatcattctggatggg
cagagtgatgatgtgcttgctgacacagttgcagtgtatgtacagtacacaagcagtgat
gggcctccagcaactgaattcctgtctcttcaggaactgggtttttctacaacagacagt
tacctccaagcattagacagggccttttccagcctgggaattcgattgcaggatgagaag
ccgactattggcttgggagttgatggtgctaacattaccgccagcctgagagcaaacttg
ttcatgacaatcagaaagactttgccatggcttctctgcttgccctttatggtacacaga
ccccatttggagattttggatgcaatcagtgggaaagaactgccatgcctggaggagctg
gaaaacaatctgaagcagctgctcagtttctatcgttattccccccgacttatgtgtgag
ttgagggtcactgcttccaccctgtgtgaggagactgagttcttgggtgacattcgagca
gtgaagtggatcattggggagcaaaatgtgctcaatgctctcatcaaggattaccttgag
gttgtggcccatctcaaagatgtcagtggccagacccaaagggcagatgcttctgccatt
gccttggccctcctgcagttcttgatggactaccagtcaattaaacttatctacttcctg
ctggatgtgattgctgtactttcacgccttgcctacgtcttccaaggggagtaccttctt
gtgtcgcaagtggatgataaaattgaggaagctattcaggagatcagtcggctagcagac
tcaccaggggagtaccttcaggaatttgaggaaaacttccgtgaaagctttaatggcatt
gctgtgaaaaacctacgggtggctgaagccaaattccagtcaatcagagaaaagatctgc
cagaagacccaggtgattctagcccaaaggttcgattcccgtagccggacatttgtgaaa
gcctgtcaggtatttgaccttgcagcttggcccagaagcactgatgagctcatgagctat
gggaaggaggatatggtacaaatatttgaacacctggagacggtcccatcattttccaga
gaggtttgcagagagggaatggacacccaagggagtttgctgatggagtggcgagaactc
aaggtggattattataccaaaaatggttttaaagacttactcagtcacatttgtaaatac
aaacagagattccctctcttaaataaaatagttcagatcctcaaagtccttcccacctca
tcggcctgctgtgagaaggggcgcaatgccctgcagagagtgcgcaaaaataaccgctct
cggctcacactggagcagctcagtgacctgttgacgattgctgtcaatgggccccccatt
gccaactttgattgcaagcgggcactagatagttggttcgaggaaaagtcgggcaatagt
tatgcactgtcagctgaaatgctgagcaggatgtcatctcttgatcagaagccgatgttg
cagagtgtggaccatggctctgagttttaccccgatatttag

DBGET integrated database retrieval system