KEGG   Gallus gallus (chicken): 423187
Entry
423187            CDS       T01006                                 

Gene name
ARFGAP2
Definition
(RefSeq) ADP-ribosylation factor GTPase-activating protein 2
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    423187 (ARFGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    423187 (ARFGAP2)
Membrane trafficking [BR:gga04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    423187 (ARFGAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 423187
NCBI-ProteinID: NP_001029043
CGNC: 51916
Ensembl: ENSGALG00000008247
UniProt: E1C2V9
Position
5
AA seq 525 aa
MMAAEPSKTEIQTLFKRLRAAPANKSCFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVH
LSFIRSTELDSNWNWFQLRCMQVGSNANATAFFRQHGCTTTDANAKYNSRAAQMYREKIR
QLASAAMAKYGTDLLIDGLSGAPGHSPDKSDADFFMEHTQSSRTWDVADASQNPAQSSLD
MEKAPKSSESSEPSHPSQGPSIDLLSTSPKAPIELKSSLIGKKKPGAAKKGLGAKKGLGA
QKVSSQSFSEIERQAQVAEQLREQQAVESRKQAEESIVTSMRLAYQELQLDRKKEEKKLQ
NLEGKKREQAERLGMGLVSRSSVSHSVMSEMQVIEQETPLAAKSSRSQLDLFEDGGGFTS
GPPKYKYNPFSFEDAFGSRWETDSSWGMDKDEEPEVTVSSIRPISERPTSRRDMENRTSV
VESNEARQKFAGAKAISSDMFFGREADAEYEARSRLQQLSGSSAISSADLFGEAENVHSG
GVSIGNVLPAADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgatggcggcggagccgagcaagacggagatccagactcttttcaagcggctccgggcg
gcgccggccaacaagtcgtgcttcgactgcggcgccaagaacccgagctgggccagcatc
acctacggggtcttcctgtgcatcgactgctccggcgtccaccgctccctgggcgtgcac
ctcagcttcatcaggtccacagagctcgattctaactggaactggttccagctgaggtgt
atgcaagtgggcagcaatgccaatgcgactgctttcttccgccagcatggctgcactaca
acagatgccaatgctaagtataacagtcgagctgcccagatgtacagggagaagatccgg
cagctggcaagtgctgccatggccaagtacggcactgacttgcttatagatggactcagt
ggtgcccctgggcattcccctgacaagagtgatgctgatttcttcatggagcacacacag
tcttccagaacctgggatgtagcagatgccagccagaatcctgcacagtcttccttggac
atggaaaaagcaccaaagtcatcagaaagcagtgaaccatcacatccaagccaaggccca
tctattgacttattgagcacatctcctaaagctcctatagaacttaaatcctccctcatt
ggaaagaagaagccaggagctgccaagaaagggttgggtgccaaaaaaggtcttggagcc
caaaaagtgagtagccagagcttcagtgagattgagcggcaagctcaggtggcagagcag
ctgagggagcagcaggcagtggagtccaggaaacaagctgaggagtccatagtcacctca
atgcgactggcttatcaggagctgcagcttgatcgaaagaaggaagagaagaagcttcaa
aaccttgaagggaagaagcgtgaacaagcggagaggctaggcatgggcttggtgtcaaga
agttctgtttcacactcagtgatgtctgagatgcaagtaattgagcaggagacgccactg
gctgcaaagtcttcccgctcccaattggacttatttgaagatggtggaggcttcacatct
ggaccccccaagtacaaatataatcccttctcatttgaagatgcctttggctcgcgatgg
gaaacagactcctcatggggtatggacaaagatgaggaaccagaggtgacagtttccagt
attcggccaatttcagagaggcctaccagtaggcgggatatggagaacaggacatcagtt
gtggaatctaatgaagctcggcagaagtttgcaggggctaaagccatctcttcagatatg
ttctttgggcgggaagcggatgctgagtatgaagccaggtcccgactacagcagctctcg
ggcagcagtgctatcagctctgcagacctgtttggagaggctgagaatgtgcactcaggt
ggtgtatcaattggaaatgttctgcctgctgctgatattgcacagtttaagcaaggagtg
aagtcagttgctggcaagatggctgtcctagccaatggggtgatgaactccctccaggat
cgttatggctcatattga

DBGET integrated database retrieval system