KEGG   Gallus gallus (chicken): 423195Help
Entry
423195            CDS       T01006                                 

Gene name
CHRM4
Definition
(RefSeq) muscarinic acetylcholine receptor M4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    423195 (CHRM4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    423195 (CHRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    423195 (CHRM4)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    423195 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 423195
NCBI-ProteinID: NP_001026362
CGNC: 6339
UniProt: P17200
Position
5
AA seq 490 aa AA seqDB search
MHNLSAQPWQAKMANLTYDNVTLSNRSEVAIQPPTNYKTVELVFIATVTGSLSLVTVVGN
ILVMLSIKVNRQLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIKGYWPLGAVVCDLWLA
LDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWILSFILWAPAILF
WQFIVGKRTVHERECYIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVRRHK
PESRKERKGKSLSFFKAPPVKQNNNNSPKRAVEVKEEVRNGKVDDQPSAQTEATGQQEEK
ETSNESSTVSMTQTTKDKPTTEILPAGQGQSPAHPRVNPTSKWSKIKIVTKQTGTESVTA
IEIVPAKAGASDHNSLSNSRPANVARKFASIARSQVRKKRQMAAREKKVTRTIFAILLAF
ILTWTPYNVMVLINTFCETCVPETVWSIGYWLCYVNSTINPACYALCNATFKKTFKHLLM
CQYRNIGTAR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacctctccgcgcagccctggcaggcgaagatggccaacctgacctatgacaac
gtcaccctcagcaaccgctctgaggtggccatccagccccccaccaactacaagacggtg
gagctggttttcatcgccacggtcaccggctcgctcagcctcgtcaccgtggtggggaac
atcctggtgatgctgtccatcaaagtgaaccgccagctccagactgtcaacaactacttc
cttttcagcctggcctgcgccgacctcatcatcggagtcttctccatgaacctctacact
gtctacatcatcaaaggctactggccactgggggccgtggtgtgcgacctgtggctggcc
ctggactacgtggtgagcaacgcctcggtcatgaacttactcatcatcagcttcgaccgg
tacttctgtgtcactaagcccctgacgtacccagccaggaggaccaccaagatggcgggg
ctcatgatcgcagccgcgtggatattgtccttcattctctgggcccctgccatcttgttc
tggcagttcattgtgggcaagaggacagtccacgagagggaatgctacatccagttcctc
tccaacccggcggtgaccttcggcacggccatcgctgctttctacctgcccgtggtcatc
atgacggtgctgtacatccacatctcgctggccagcaggagcagggtgaggagacacaag
cccgaaagcaggaaagagaggaaaggcaagtccctcagcttcttcaaggctcccccagtc
aaacagaacaacaataactcccccaagagggccgtggaggtgaaagaggaggtgaggaat
gggaaggtggacgaccagccctcagcacagacagaggccactggccagcaggaggagaag
gagacctccaatgagtccagcacagtcagcatgacccagaccaccaaagacaagcccaca
acggaaatcttgccagcgggacaaggacagagcccggcccatcctcgggtgaacccgact
tccaagtggtccaagatcaaaatcgtcaccaagcagactgggaccgaatcggtcaccgcc
atcgagatcgtcccagctaaggcaggagcctctgaccacaactccctgtccaacagccgc
cctgccaatgtcgccaggaagtttgccagcatcgccaggagccaagtgcggaagaagcgc
cagatggcagcccgggagaagaaggtcacccggaccatatttgccatcctgcttgccttc
atactcacgtggactccgtacaatgtgatggtcctcattaacaccttttgcgagacctgc
gttcctgaaaccgtgtggtccatcggctactggctctgctatgtcaacagcaccatcaac
ccagcctgctatgccctctgcaatgccacgttcaagaaaacctttaagcacctcctcatg
tgccagtacaggaacattggcacggccagataa

DBGET integrated database retrieval system