KEGG   Gallus gallus (chicken): 423196
Entry
423196            CDS       T01006                                 

Gene name
MDK
Definition
(RefSeq) midkine precursor
  KO
K06828  midkine
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    423196 (MDK)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   423196 (MDK)
SSDB
Motif
Pfam: PTN_MK_N PTN_MK_C
Other DBs
NCBI-GeneID: 423196
NCBI-ProteinID: NP_001106760
CGNC: 51919
Ensembl: ENSGALG00000008367
UniProt: P24052
Position
5
AA seq 142 aa
MQPRGLLLLLALLLLAAAAEAAKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSC
GDESRKLKCKIPCNWKKKFGADCKYKFERWGGGSAKTGVKTRSGILKKALYNAECEEVVY
VSKPCTAKMKAKAKAKKGKGKD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcagccccggggcctcctcctcctcctggcactgctgctgctggcggccgctgccgag
gctgccaaagccaagaaagagaagatgaagaaggagggttccgagtgccaggactggcac
tgggggccctgcatccccaacagcaaggactgcggcctgggctaccgcgagggcagctgc
ggcgatgagagcaggaagctcaagtgcaagatcccctgcaactggaagaagaagtttgga
gctgactgcaagtacaagtttgagaggtggggaggtggcagcgccaagacgggtgtgaaa
acacgctcaggcatcctgaagaaagcgctgtacaatgctgaatgtgaggaggtggtctat
gtgagcaagccctgcaccgccaagatgaaggccaaggccaaagcaaagaagggcaagggg
aaggactag

DBGET integrated database retrieval system