KEGG   Gallus gallus (chicken): 423200
Entry
423200            CDS       T01006                                 

Symbol
LARGE2
Name
(RefSeq) LARGE xylosyl- and glucuronyltransferase 2
  KO
K09668  glycosyltransferase-like protein LARGE [EC:2.4.2.- 2.4.1.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00515  Mannose type O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    423200 (LARGE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    423200 (LARGE2)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     423200 (LARGE2)
   2.4.2  Pentosyltransferases
    2.4.2.-  
     423200 (LARGE2)
Glycosyltransferases [BR:gga01003]
 Glycan extension
  O-Glycan
   423200 (LARGE2)
SSDB
Motif
Pfam: Glyco_transf_49 Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 423200
NCBI-ProteinID: NP_001004404
CGNC: 51920
Ensembl: ENSGALG00000008418
UniProt: Q66PG4
Position
5:complement(24136219..24156541)
AA seq 739 aa
MLCSWRVKLKLLLATITLAVLLSWLYLFVGSLEYGRFLLLPPCLGEQPSRDVEREALASQ
VRRVEEENQQLRMQLGQVQAEGSDGNPQWAASAEDGPPLGGERNNRTACPEQRMVRKCEL
LHVAIVCAGHNASRDVVTLVKSILFHRKNPLHFHFITDSVAHQILQTLFQSWMVPSIHVS
FYNADDLKPEVSWIPNKHYSGIYGLMKLTLTKALPSNLSKVIVLDTDITFATDIAELWAV
FGKFSEKQVIGLVENQSDWYLGNLWKNHKPWPALGRGFNTGVILLLLDRLRRLGWEQMWR
LTAERELMSMLSTSLADQDIFNAVIKQNPALVYRLPCFWNVQLSDHTRSELCYTEVSDLK
VIHWNSPKKLRVKNKHVEFFRNLYLTFLEYDGNLLRRELFGCASLPSPPSDQLQQALEEL
DEDDPCYDFRRQHLTQHRVHLFFLQYEFLALPNPTDVTLVAQLSMDRLQMLEAICKHWAG
PISLALYMSDAEAQQFLRYAQASEVLSARRNVAYHIVYKEGQFYPINLLRNVALANTQTP
YVFLTDIDFLPMYGLYDYLRNSIQQLELPHRKAALIVPAFETLHYRLTFPKSKAELLSML
DMGSLYTFRYHVWPKGHAPTDYAKWRTATVPYRVAWQPDFEPYVVVRRDCPKYDQRFVGF
GWNKVSHIMELDAQEYELLVLPNAFMIHMPHAPSFDISKFRLSAGYRGCLQTLREEFHQD
LSRKYGAAALKYLTAERNL
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgctgtgctcctggcgtgtcaagctgaagctgctgctcgctaccatcaccctcgccgtc
ctcctctcctggctctacctctttgtgggcagccttgaatacggccgctttctcctgctg
ccgccgtgcctgggcgagcagccgagtcgggatgtggagcgggaggcactggcctcgcag
gtgcgccgggtggaggaggagaaccagcagctccgcatgcagcttggccaggtgcaggca
gagggcagcgatggcaacccacagtgggcggcctctgccgaggatgggccccccctggga
ggtgagaggaacaaccgcactgcctgccccgagcagaggatggtgcgcaagtgtgagctc
ctgcacgttgcaattgtgtgtgctggacacaacgccagccgggatgtggtcaccctggtg
aaatccatcctcttccacaggaaaaaccctctccactttcacttcatcacggattcggtg
gcccaccagatcctccagacgctcttccagtcctggatggtgccttccatccacgtcagt
ttctacaacgccgatgacttgaagccagaggtgtcgtggatccccaacaagcactactct
ggcatctacgggctgatgaagctgacgctcaccaaggcactgccctccaacctctccaag
gtcatcgtcttggacactgacatcacctttgctactgacattgctgagctctgggccgtc
ttcgggaagttctctgaaaagcaggtgattgggctggtggagaaccaaagtgactggtat
ttgggcaacctctggaagaaccacaaaccatggccagcactgggacgtggcttcaacacg
ggggtgatcctgctcttgctggaccgcctgcgtcgcctgggctgggagcagatgtggcgg
ctgacagcagagcgggagctcatgagcatgctctccacctcactggctgatcaggacatc
tttaatgcagtgatcaagcagaacccagccctggtgtaccggctcccgtgcttctggaat
gtgcagctctccgatcatacccgctcagagctgtgctacactgaggtctcagatctcaag
gtgatccactggaactcgcccaagaagctgcgagtgaagaacaagcacgtggagttcttc
cgcaacctctacctgaccttcctggagtacgatgggaacctgctgcgcagggagctcttt
ggctgtgccagtctccccagcccgcccagcgaccagctgcagcaggcgcttgaggagctg
gacgaggatgatccctgctatgatttccgccggcagcacctcacccaacaccgcgtccac
ctgtttttcctgcagtacgagttcctggcccttcccaaccccactgatgtcaccctcgtg
gcccagctctccatggacaggctgcagatgttggaggccatctgcaaacactgggctggc
cccatcagcctggcgctgtacatgtcagacgcggaggcccagcagttcctgcgctacgcc
caggcctcggaggtgctgagtgcccgccgcaacgtcgcctaccacatcgtctacaaggag
gggcagttctaccccatcaacctcctgcgcaacgtggccttggccaacacgcagacgccg
tacgtctttctgactgacattgacttcctgccgatgtacggcctctacgattacctcagg
aactccatccagcagctggagttgcctcacaggaaggcagctctcattgtgccggcattt
gagaccctgcactaccgcctgaccttcccgaaatccaaagcagaactgctctccatgctg
gacatgggctccctctacaccttcaggtaccacgtgtggccaaaaggccatgccccaact
gactatgccaagtggcgaacagccaccgtaccgtaccgtgtggcgtggcagccggacttc
gagccttacgttgtagtgaggcgagactgccccaagtacgaccagcggttcgtgggcttc
ggctggaacaaggtgtcccacatcatggagctggatgcacaggagtacgagctgctggta
ctgcccaatgccttcatgatccacatgccccacgctcccagcttcgacatctccaagttt
cgcctgagcgcagggtaccggggctgcctacagacactgcgggaggaattccaccaggac
ctgtcgcggaaatacggggctgctgcactcaaatacctcaccgccgagaggaacctatga

DBGET integrated database retrieval system