KEGG   Gallus gallus (chicken): 423216
Entry
423216            CDS       T01006                                 

Gene name
LTK
Definition
(RefSeq) leukocyte tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423216 (LTK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    423216 (LTK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     423216 (LTK)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   423216 (LTK)
CD molecules [BR:gga04090]
 Proteins
  423216 (LTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich
Other DBs
NCBI-GeneID: 423216
NCBI-ProteinID: XP_004941681
CGNC: 51922
Ensembl: ENSGALG00000008615
Position
5
AA seq 1455 aa
MSPAAPAPLRVWVTAVVVVSCSGSHEVNSSAPIPPEKFSPIRNRMVSFLQPSEPEISCII
GSSCSWMTSTDSFGKPDWVLSSVSVLVSQERQQLLLENSSSQGGVEGDIFLLNTSRLPDR
CKFSLHSPILPGSVDSCLLELAVYSQDAVPVLQRFTVEIRYVDTNRNIIISLKVGHEEDA
GVKWNSMMAQIGRIERPFKITLLYSNCGAQEAGLLAVGSLQLRNCFHDKENPDLSIYNKG
SSFPCLHGGCVSHLQICEFISDCPTKEVEGMRCDSLPEGSHCSFEKGSCGWTLNETAASP
WSIKGFNDMIHSGSFVGSALQSTGGHFLYLRADSNHTNGMAKAFSTSLPASIATEDYQIQ
FSVHVFGSYNGTISFSVREERNGVPVTLPMWERAGSWSDHWFLITLPMPVLQNRFQLQLL
ATWGWNSQADIAIDNITFGMDCFADGRQPTHFKGKHQFPREISSPDEHLLNPLEEPSLPG
DTSVVLWWFSTCGASGPHGPTQAQCDNAYRGSNVSVIVEKEGRLRGVQVWRVPATNRYRI
SAYGAAGGKGAKNHNERSHGVFISATFQLEKDELLYILVGQQGEDACPGANPQTQKICLG
ESSVIEEDYKKKKDLKDWAGGGGGGGGATYVFRQKDGIFEPLLIAAGGGGKAYLKAQDNS
LDDVPLEQFENSTAVPGVSGRTGAAGGGGGWQDVTLLPQAGKSLLEGGEGGQACHQALAK
LQWATSGGFGGGGGACTSGGGGGGYRGGHASKNDDITAGGQYGISFVNPIGEIFLHPLAA
VENDGEVEVQIYLNCSHCHSDNCKRDPDTNLPVCQCEMGAVLANDNVTCTVPQGHVPEGH
LPLPLLLAVVAVIVMLGMILTGGSLSIIYHLKKQQLEGARARLQSPEYKLSKIRTSAIMT
DYNPNYCFAGKAATLSELKEIPRKNISLLRALGHGAFGEVYEGTVVGIAGDPSPLQVAIK
TLPEVCSEQDEMDFLMEALIISKFNHQNIVQCIGVSLQTLPRFILLELMAGGDMKSFLRQ
NRPRVNQPSVLTMQDLLNIARDIACGCKYLEENHFIHRDIAARNCLLTCTGAGRIAKIGD
FGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGIFTSKTDTWSFGVLLWEIFSLGYMPY
PCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHSPEYRPNFSTILERIKYCTQDP
DVINTQLPMECSPTPEDEGNTVVRPSVPSGIVPLLVSPSLTPQMTPKSLDTHCTGHKLVQ
CPQELLVENLSNRTARGPSLPCLSDFNSASWIQNSNQKLEFSNPPTHRLKNKTKNLWNPT
YGSWVLENSCHLSPISKLKVTPEREDSGFDGNCSSSPSSRASPASPSRNNCPHLDIGGIE
LVKLQNFPCGNVNYAYDDLCFGTDHSPSVLTGVRAAVLRSSSLHTDEKPFYKTEKAARER
DSGLSLSDDLSVTPV
NT seq 4368 nt   +upstreamnt  +downstreamnt
atgagccccgctgccccggcaccgttgcgagtctgggttaccgccgtggttgttgtctcc
tgttctggatcacatgaagtaaactcttctgcaccaattcctcctgagaagttctccccg
ataagaaataggatggtgtcatttcttcagccttctgaaccagaaatctcttgtatcatc
ggctcaagctgctcatggatgacgtctacagatagttttggaaaaccagactgggtatta
tcttcagtcagtgtcctggtgtctcaggagaggcagcagctgcttctggaaaatagctcc
tcccaaggaggtgttgaaggagacattttccttctgaacacgagtaggctgccagataga
tgcaagttcagcctccacagcccaatcctgcctgggagcgtggactcttgtttgctggaa
ctagctgtatattcacaggatgctgttcctgttctccagcggttcacagttgaaatcaga
tatgtggacacaaacagaaatataataatttctctgaaagttggccatgaagaggatgct
ggggtgaaatggaactccatgatggctcagattggccgaatagaaagaccttttaaaatc
accttgctgtattcgaactgtggcgctcaagaggctggactgctggcagtgggctccttg
cagctcagaaactgcttccatgataaagaaaacccagatctttctatatataacaaaggc
tcttccttcccctgccttcacggaggctgtgttagccacttacaaatctgtgaattcatc
agtgattgccctaccaaagaagtggaaggaatgagatgtgatagtctcccagagggttca
cattgctcttttgaaaagggttcgtgcggctggacactgaatgagactgcagcatctcct
tggtctatcaagggttttaatgacatgattcacagtggttcatttgtagggtctgccttg
caaagcactggaggacactttctctatctgcgagcagatagcaatcacacaaatggtatg
gccaaggctttcagtacaagcttgccagctagtattgccactgaagattaccagatccaa
ttctcagtgcatgtttttggcagctacaatggtaccatctccttctctgtcagggaagag
agaaatggagttccagttaccttgccaatgtgggaaagagcaggaagctggagtgaccat
tggtttctcatcactttaccaatgccagtgcttcagaacaggtttcaactgcaacttctg
gcaacctggggctggaattcccaagctgacatcgctattgacaatattacgtttggaatg
gattgctttgctgatggaagacaaccaactcattttaaaggaaagcatcagttcccacgg
gagattagtagtcctgatgagcatcttctgaaccccctggaagagccttccctcccaggg
gacacatctgttgttctctggtggttctcaacatgtggtgccagtggtccacacgggcca
actcaagctcagtgtgacaacgcctacaggggcagcaatgtgtcggtgattgtagagaag
gagggcaggctccgaggagtgcaagtctggagagtgccagctacaaaccggtacagaatt
tctgcctatggagcagctggagggaagggagccaaaaaccacaatgagaggtcccacggg
gtcttcatctcggccaccttccagctggagaaagatgagctgctgtacatcttagtgggg
cagcagggggaggatgcctgccctggggccaatcctcagacccagaagatctgcttaggg
gagtcatctgtcattgaagaagattacaaaaaaaaaaaggacctgaaggactgggctgga
ggaggtgggggtggaggaggagcaacctacgtctttagacagaaggatgggattttcgaa
cctttgctcatcgcagcaggaggaggaggaaaagcctatctgaaggctcaggacaactcc
ctggatgacgtacctctggagcaatttgagaacagcactgcagtaccgggagtcagtgga
agaactggggcagcaggtggaggtggtggctggcaagatgtgactctgcttcctcaagct
gggaaatccctcttggaaggtggagaagggggtcaagcttgtcaccaagcattagccaag
ctccagtgggctacctctggtggttttggtggtggaggaggagcttgtacttctggtgga
ggaggtggaggttacagaggggggcatgcctctaaaaatgatgatatcacagctggtggg
cagtatggcatctcgtttgtgaatcccattggagagatcttcttgcatccccttgcagcc
gtggagaatgatggtgaggtggaggttcagatctatcttaactgtagccactgccactca
gacaactgtaagagagaccctgacaccaacctgccagtctgccaatgtgagatgggggct
gtgctagccaatgacaatgtcacctgcactgttccacagggtcatgtcccagagggacat
ctgcctctcccactcctcctagctgtggtggctgtaattgtgatgctcggaatgatcctc
actggtggcagcctatctatcatttatcaccttaagaagcagcaactggaaggagccaga
gcacgactgcagagcccggaatataaactgagtaaaatccgcacatcagccatcatgaca
gattacaaccccaactactgctttgctgggaaggccgccactctgagtgagctgaaggag
atcccacggaagaacatctctctgcttcgggcactaggacatggtgcgtttggtgaggtt
tatgaaggaacagtggtaggcatcgcaggggatcccagtcctctccaagtggctattaag
acactgccagaagtctgctccgagcaagatgagatggatttcctgatggaagcactgatt
atcagtaagttcaatcatcagaatattgtgcagtgcattggtgttagcctgcagacgctg
cctcgcttcattcttcttgagctcatggctggaggagatatgaagagttttcttcgtcag
aatcgacccagagtgaatcagccatccgtgctaacgatgcaggacctgctgaacatagct
agagatatcgcctgtggctgtaaatatctggaagagaatcatttcatacacagagatata
gctgcaaggaattgccttttgacctgcactggggcaggtcgaatagccaaaatcggtgac
ttcgggatggccagagatatctacagagcaagttactatcgcaagggaggaagagccatg
cttcctgtcaagtggatgccaccagaagcttttctagaaggcatttttacctccaaaact
gacacctggtcctttggtgtccttctctgggagattttctctctaggctacatgccatat
ccctgcaaaactaatcaggaagtgctggaatttgtcaccagtggaggaagaatggacccg
ccaaagaactgtccagggcctgtgtaccgcatcatgacgcagtgctggcagcacagccca
gaataccggccaaacttctctaccatcctggaaagaattaagtactgcacacaggaccct
gatgtgatcaacacacagctgcccatggagtgtagcccaacaccagaggatgaagggaac
acagttgtgcgcccaagtgttcccagtgggatagtgcccctgttggtgagcccttctctt
acacctcagatgacaccaaaaagcctggatacccactgtactgggcacaaactcgtacaa
tgtccacaagagctactggtggagaacctcagcaaccggactgctcgagggcccagcctg
ccatgcctcagtgatttcaacagtgcgtcctggatccagaattcaaaccagaagttagaa
ttcagcaatccaccaacccacagactgaagaacaaaactaaaaacctttggaatccaacc
tatggatcatgggtgctagagaacagctgtcacttaagccccatctccaaactgaaagta
actccagagcgagaagattcaggctttgatggaaattgcagttcttctcctagttctcgg
gcatctccagcatctccaagtcgaaacaactgtcctcacttagatattggtgggatcgaa
ctggtgaaactccagaatttcccctgtgggaatgtaaattatgcatatgatgatctgtgc
tttggcactgatcactcaccgtcagttttgacaggggtcagagcagctgtgctaaggagc
tccagtctgcatacagatgagaaacctttttataaaacagagaaagcagcaagagagagg
gactctggtctgtctctgtcagatgacttgagtgttacaccagtataa

DBGET integrated database retrieval system