KEGG   Gallus gallus (chicken): 423220
Entry
423220            CDS       T01006                                 

Gene name
MGA
Definition
(RefSeq) MAX gene-associated protein isoform X4
  KO
K23399  MAX gene-associated protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    423220 (MGA)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    423220 (MGA)
SSDB
Motif
Pfam: T-box DUF4801 HLH
Other DBs
NCBI-GeneID: 423220
NCBI-ProteinID: XP_015142613
CGNC: 6567
UniProt: A0A3Q3B130
Position
5
AA seq 3228 aa
MEKQQIVLANRDGGTVSSTAPAFFVILKQQQGNGKADQGILVANRDACALASSVLMPVKP
KIKTCLPADCVSGGITVTLDNNSMWNEFYHRNTEMILTKQGRRMFPYCRYWITGLDASQK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGQYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPADKATEVIQLNGPDVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSRPQRDVKQNNSFELEEGNVFSCASIRGCPAEVDTL
GLHRRIDSSFTGQNSSDMNLEKESFNAEQGFVGFLDTGLPSGDMPKLKQEVTESPIASSY
ESSSRVTSPLDPSGQFNVVIKEEPVDDYDYETNICTEGVSVKQEDTDEETDEYSNTDDDD
PVLQKCLRRYSEADRNDGDFKSRKRVLSSPSGVAKAKMLKLDSGKMPVVYLEPCAVTKST
VKISELPQTMLSSCKKDKSPLNTVLDSLPVCFENHKGSYSDTASITEEIPMKKMSPGNKL
AQKYSSIKEAQWILSKSPNFNLRSSVGCPVSDKEICGRKKTGVLKNSASPKGSGSSQNSL
SGTTKRGRPRKLKIAKAGRPPKGIGKPVITSKNSPMGPGSILPDVKPDLEDVDGVLFVSF
ASKEALDIHTVDRAGGEESQNLQAPLLTTNDPDCQARIQVLEKELMEELKTLRHKQVIHP
SLQEVGLKLNSVDPTMSIDLKYLGVQLPLSYSNYSLWSYPGTNPNSPDAGFPFVSRTGKT
NDFRKIKGWRGKLHGASRNEGGSSEGSLKNRSAFCSDKLDEYLENEGKLMETSMGFSSST
PTSPVVYQLPTKSTSYVRTLDSVLKKQSTVIPSTSYTFKPASLSSTSRKARTQNKQTSSN
SRGKSSYKPILPSPFPAKQKQNFSASVEKAAKSSSCLTSQADGFLVPHLDESILPKQISL
RHAPQQQQAARPPGLSKSQVKLMDLEDCALWDGKPRTYITEERADISLATLLTAQASLKN
KPIHKIIRRRAPPCNNDFCRLGCICASLALEKRQPTHCRRPDCMFGCTCLKRKVLVVKGG
SKHKKILKKAVRGSLVFYGSQEEQQEDEDAEEEGVGEEDEMKQKDKRKRKKVEYTICDSE
PEKPLRNCPLWVKVEGEIDPEPIYIPTPSVIEPVKSTVLPNPEVVLSSKHRSSSGVKTGR
VYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYEPGKEEKKQQKDQKDSQSSFVKMYEQ
GLPSSKKESSKKELSKKESSKKESCKKETSEINKDPEKCGEKSSWSSHSEGDTSSASCVH
PTTPCAPTKLIEIISDCSWNEDCNKILTILSQHINSNMPQCLKVGSLIIELASEHKAQDA
NSPPVYSSRVKISVPSYQDSDEKPESPDLETPDSGVPSCKKAENVKFFQAYTLDKLREKL
HGGKGLPFYAGISPAGKLVVYKRKANMSHSGLIQVNDKRYPQAKLLLGQMGALHPAGRLA
AYVTGRLRPTVLDISTLSTVISKVASSASGTPSVQVPTTSAPKTTSSISTTSNPSVTTLK
ALIPPLRQIAARPSPGGVFTKFVMNKVGALQQKIPSVSTCQPLSGPQKFSINPTPIMVVT
PVVPSSLSPAHCTVSPGVTTATTTFPVTVESTSVAPSTVSAPSQTRANEPASSPPAITVT
GASATPGINTSTTSSPATPTATVNVTKATVIAAPVPTLSLPTVVTAPTITCPVITTSPST
VVLTTAVATSVVTTPASSVSSVPIILSGVKSAPSLAPKREDATPQAQALNKTPPKISPGA
EKRVGPRLLLIPVPQTSPALRPLNNVQLPQKQRMILQPLRSPGGVNLFRHPNGQIIQLVP
LQHFRAPGAQPNAQPNVQQPVMFRNPGSVVGIRLPAPAKHPEPPVSSASSVSSSVSSTPP
VTNATVQTAGPKSSSVSTPATQASSVSPSVTSYVSQAGTLTLKISPPAASNVTNQTATES
KITGNSGVLPASNANVVPLQSGSFALLQLPGQKTVPNSILHHFASLQMKKDSKKISQKDD
SGAAQQMETGKNLHSEETEVAQSEASVSGGKQEEKEVSVNQPNNVEESVSGTVTPVKNST
ALEALEQESKVLQGSGDDGPSLQNDVSTDVISSDHSYISEKPSDEENEAVTEEKEDSVCS
ENVGAVSTNSETVCESLDHSLVAPLNDAHPQSLKDQETAQLKNHGKEGIHAEWEDKPAKE
QEGEVQAHMKENNKVGSRQSQKQQDTQLENKKEQTGTELPQNKKEFQDGPVQPEVEKKEC
KASAEAESLREKKTSKSEISSAEEQHNALGDKQVVSTEEGKTNVAMQEDSKNKEQGAVDS
QEEIKTVEDTVIHANSSWSKISSIAPASENKSETDNKADRSDKSVFMVTEQKAQESRHHK
KNSMPNTDTTDYMEEEEDDDDDEDEKTDDSADEMLDGASDFSSEEEIDVEKVDACEYSED
DEQVDIETVEELSEKINIARLKATAANIRPSKEKYHARNSSDEKLSESPTKQNPPVWSRR
QKSEEEAFAHYRQTHTANERRRRNEMRDLFEKLKRALGLHSLPKVSKCYILKQALDEIQG
LTDQADKLTGQKCILARKQDTLIRKVSILSGKTEEVVLKKLEYMYAKQKAVEAQKKKKNV
QPTESVVTSPASTHQEASSALPRDLSKVPMTSRRGKPLILARKGSHATENTSSSLTLTAA
SLVMTPQGQVLTLKSPLVPGQVAAVPSTLLQAELKPRAVSNTMTAQPGIASVMIQLPGSA
VPVQVKGILANSAIPITLSTVAGNPAPSAVVPAPESHSESEDSFMMPKIVNVTSLAAEES
LSLNPNRNKNSNTSAASAQASEKSLVMPLESRKSDSILLEEKNKPCPGDSDGEGRSTAGS
AKGFFENKDGFAQLQNVSCAKEPPESFGKKLCIGELVGSQARKKDGDHGGERLKTKELPF
RKLQIKDSRIEMELRKVASAMEEAELDAGELLSSIEESDDTDETLTSLLNEIAFLNQQLN
DDASGMSELPSALSSDFSHGDAEARRGTAGDLTAADGSSFQFGHLGGAFKDLSEVPEGSG
SLSPLLLHLEDDDLTEGDKNSGEPSSEADVLKIVIGAEMKDALPNLSVTSGGNGKTVANL
AEATGVTPPILQMKTNPEASNADTLWRPMPKLAPLGLKVASLPVDSEGQSAKVMPLLAPI
VAKLAPAGGKASSVTAQEGQDNKVMPALAPVGTKFSNSGTLPSNSVGK
NT seq 9687 nt   +upstreamnt  +downstreamnt
atggagaaacagcagattgtgctggctaaccgggatggtgggacggtgtccagtacagca
cctgccttttttgttatcttgaaacaacagcagggaaatggcaaagctgaccagggaatc
ctagtggccaaccgtgacgcttgcgctctggccagtagcgtattaatgccagtaaaaccc
aaaatcaaaacctgcctccctgctgactgcgtctcagggggcatcactgtcaccctagac
aataacagtatgtggaatgaattctaccatcgcaacacagagatgattctgacaaagcag
gggaggcgcatgttcccatactgccgatactggattacaggtctggatgccagccagaag
tacatcctggtcatggacatctcccccgtggacaatcaccgatacaaatggaatggccgc
tggtgggagcccagtgggaaggcagagccccatgtgcttggacgagtgtttattcatcca
gagtcgccttccactggccagtactggatgcaccagccggtatctttctacaaactcaag
cttaccaacaataccctggaccaggagggtcatatcatcctacattctatgcaccgctat
ctgccacggcttcacttggttcctgcagacaaagccacagaagtcattcagctcaatggc
ccagatgtccatacgtttacctttccacagacagagttctttgcggttacagcgtaccag
aatattcagattacccagctgaaaatagactacaatccttttgctaagggattcagagat
gatggcttgaatagtcgacctcagcgtgatgtgaaacaaaacaatagctttgaactggaa
gaaggtaatgtttttagctgtgccagcattcgtggttgccctgctgaagttgacacgttg
ggattacatcggagaatagattcttcattcactggtcagaactcatcagacatgaatctg
gagaaagaatcctttaatgcagaacaaggctttgtaggtttcttggacactggcctgcct
tccggtgatatgccaaagctaaaacaagaagtcactgagagtcccattgctagcagttat
gagagcagctcccgagtaacatccccattggaccccagtgggcagttcaacgtagtcatt
aaagaggaacccgtcgatgattatgactatgagacaaacatctgcacagaaggagtaagc
gtgaaacaggaagacacagatgaagaaactgatgagtattctaatactgatgatgatgat
cctgtcctacaaaaatgcctgaggagatacagtgaagcagatagaaatgatggagacttc
aagtctaggaagcgtgtactatccagtccttcaggtgttgccaaggcgaaaatgttaaaa
ttggatagtggaaagatgcctgtggtctatttggaaccttgtgcagttacaaagagtaca
gtgaagatatctgagctaccacagaccatgctgtcctcttgcaagaaagacaaatcccct
ttgaatacagtactggattctttgcctgtctgttttgaaaatcacaaaggttcttactca
gacacagcctctataactgaggagatacctatgaaaaaaatgtctccgggaaataaactg
gcacagaaatattcctcaatcaaagaggcccaatggattctatctaaatcacctaatttt
aatcttaggagctctgtaggttgtccagtttcagacaaagagatttgtggaaggaaaaaa
acaggagtactgaagaattctgcatccccgaaaggctctggtagcagtcagaactcacta
tcaggtaccactaaaagaggaaggccacggaaactgaaaatcgccaaggctggtcggcca
cctaaaggtatagggaaacctgtcataacgagcaagaacagccctatggggcctgggagt
atccttccagatgttaagccagaccttgaagatgttgatggagttctctttgtgtccttt
gcatcaaaggaagctcttgacattcacactgttgatagagctggaggagaagaatcacag
aatcttcaggctcctttgttgactacaaatgatccagattgtcaggcaagaatacaagta
ctggaaaaggagttgatggaagaactgaaaacattgaggcataagcaagtaatacatcct
agccttcaggaagtgggattgaagttaaattctgtggacccaacaatgagcattgacttg
aaatacttgggcgtgcagcttcctctttcctactcaaattattctttgtggagctatcca
ggaacaaaccccaattctccagatgctggatttccttttgtttccagaacaggaaagaca
aatgatttcagaaagatcaaaggctggcgagggaagcttcatggtgcttctagaaatgaa
ggtggcagttcagaaggttccttgaagaatcgctcagcattctgtagtgacaagctggat
gagtatctggaaaacgaaggaaagctgatggaaacgagtatgggattctcttctagcaca
cccacttcccctgtggtgtatcagcttcccaccaagagcactagctatgtgcgaacacta
gacagtgttttgaagaagcagtccaccgtaattccatccacatcttacaccttcaagcct
gcttctctgtcatctacctcgaggaaggcaaggactcaaaacaaacagacatcttcaaac
agtagaggaaaatcatcctacaagcctatactgccttcaccttttcctgccaagcagaaa
cagaacttttcagcatcagtggaaaaggctgctaagtcaagtagctgtttgactagccaa
gcagatggtttcttggtgccacatctggatgaaagcatactgccaaaacaaataagtttg
cgccacgcaccgcagcagcaacaagcagctcgtccaccaggtttgtctaaatctcaagtg
aagctaatggacttggaagactgtgctctgtgggatggcaaaccacgaacctacattaca
gaagaacgagcagatatctctctggctaccctgcttacagctcaggcttctctcaaaaac
aaacctatccacaaaataatacgacgacgagcacctccttgcaataatgatttctgtcga
ctgggttgtatatgtgccagtctagcactggaaaaacgtcagcctacccattgccgcagg
ccagactgtatgtttgggtgtacttgcctgaagagaaaagtactggtggtgaagggtggg
tcaaaacacaagaaaatactgaaaaaggctgtgcgtggaagtcttgtgttttatggatca
caagaagaacagcaagaggatgaagatgctgaggaagagggtgttggagaagaagatgag
atgaagcagaaagacaagaggaaaagaaaaaaggtggaatacactatctgtgactcggag
ccagaaaagcctcttaggaattgtccattgtgggtaaaagtagaaggtgaaatagatccg
gaacctatttatattccaacaccatctgttattgaaccagttaaatctacagtcctgcct
aacccagaagtcgtgctttctagtaagcatagatcttccagtggagtgaaaacaggcaga
gtgtatactcctaaacccaaccccgtgattcgagaggaggacaaggatcctgtctacttg
tattttgaaagtatgatgacctgtgcaagggttcgagtatatgagcctgggaaggaggaa
aaaaagcaacagaaagaccaaaaggattcacagagttcttttgtaaagatgtatgaacaa
ggacttccatcttcgaagaaggagtcttctaagaaagaattatctaaaaaagagtcatct
aagaaagaatcttgtaagaaggaaaccagcgagataaacaaagaccctgaaaaatgtgga
gagaaaagttcgtggtcttcccatagtgagggggacacttcctccgcctcctgtgttcat
cccaccactccatgtgcaccaaccaaacttatcgagattatctctgactgcagctggaat
gaagattgcaataagatattgaccatcttatcacagcacatcaacagtaacatgccacag
tgcctcaaagtgggtagcctcattattgaattggcttcggaacacaaggctcaggatgca
aacagccctcctgtgtactcctccagagtgaaaatttcagtgccatcctaccaggacagt
gatgagaagcctgagtcacctgacttggagactcccgatagtggagtgccgtcatgcaaa
aaagcagaaaatgtaaagttctttcaggcttacacattggacaagctgcgggagaagttg
catgggggcaaaggcttgcctttttatgcaggaatttctcctgcgggaaagctggttgtc
tacaagcgcaaagctaatatgagccactcaggcttgattcaggttaatgataaaaggtat
cctcaggccaaactgcttttgggacagatgggggcattacatcctgccggtcggctagct
gcttatgtcacaggcaggctgcgacccacagtacttgatatctcaaccctcagtactgtg
atctccaaggtagcatccagtgcttctgggacaccatcagtccaggtgcccacaacatca
gctcccaaaactacatcttccatcagcactacttcaaaccccagtgtgacgactctgaaa
gctcttatcccaccactgagacagatagctgctcgaccctcacctggtggtgtgttcaca
aagtttgtgatgaacaaagttggagctctgcagcagaagattccttcagtgagcacgtgc
cagcctctgtcagggccacagaagttcagtatcaatcctacaccgataatggttgtcact
cctgtggttccctcaagtctgtctccagctcactgcactgtctctcctggagtcactaca
gccaccacaacctttcctgttactgtagaaagtaccagtgtggcaccatctactgtgtct
gctcctagccaaacaagagctaatgaacctgcctcctctcctcctgcaattacagtcaca
ggtgcttctgcaacacctggaatcaacacctctaccacttcctcacctgccactcctacc
gccactgtgaacgtaacaaaagcaactgtgattgctgctccagtaccaactctctcactc
cctactgtagtaacagcaccaacaattacttgtcctgttattacaacatccccttctaca
gttgtactaacaactgcagtagctacatctgtggtgactacaccagcttcctctgtcagt
tctgttccaattatattatcaggagtgaagtcagctccttcattagctccaaaaagagaa
gatgctactccacaagcacaagctctaaataagactcccccaaagatatctcctggagca
gagaagcgtgtaggaccgcgactgttgttgattccggtgcctcagacatcccctgctttg
cgaccgttaaacaatgtgcagcttcctcagaaacagagaatgattcttcagcctctcagg
agccctggtggggtgaacctgttcaggcatcctaatggacagataattcagcttgtcccc
ctgcagcattttcgagctccaggtgcgcagcccaatgcccagcctaacgtgcagcagcca
gtgatgttccgcaatccaggatctgttgtaggaattaggttgcctgcacctgctaagcat
cctgagccacctgtatcttctgcttcctccgtgtcttcctccgtgtcttccactcctcct
gtcacaaatgcaactgtacaaactgcagggcccaagtcatcctctgtgtccactccagct
actcaagcatcttctgtttctccttcagtaacaagttatgtgtcacaagcaggcactctg
actctgaagatctcacctcctgctgctagtaatgtgacaaatcaaaccgccactgagtca
aaaataactggcaactcaggtgttctaccagcttcaaatgctaatgttgtacctttacaa
tctggtagttttgctttacttcagctcccaggacagaagactgtaccaaactccattctt
caccattttgcatctcttcagatgaagaaggactccaagaaaataagccagaaggatgac
tcaggtgctgctcagcaaatggaaacggggaagaatttgcactcagaggagactgaagtt
gcacagtctgaggcctcagtgtcaggtggcaaacaagaagaaaaggaggtgtcagtaaac
cagccaaataatgttgaagagtcagtgtctggaacagtcacacctgttaaaaattccact
gctttagaggcacttgagcaggaatcaaaggtgcttcagggttctggtgatgatggtccc
tctcttcagaatgacgtttccacagatgttatatcgtctgaccattcatacatcagtgaa
aagccaagtgatgaggaaaatgaagcagtcacggaggagaaagaggattctgtctgttct
gaaaatgtaggggctgtttcaactaactctgaaacagtttgtgaatcattagatcattct
ctagttgctcctctgaatgatgcacatccacagagtctcaaggatcaagagactgcacag
ttgaagaaccatggaaaagaaggaatacatgctgaatgggaagataaaccagctaaagag
caggaaggtgaagtgcaggcacatatgaaagagaataacaaagtgggttctaggcagtca
cagaaacagcaagatacgcagctggagaacaaaaaggaacagacaggaactgaactgcct
cagaacaaaaaagaattccaggatggtcctgtgcagccagaagtggaaaaaaaggagtgc
aaggcctctgcagaagcagaaagcttaagagagaaaaaaacaagcaagtctgaaataagt
tctgcagaagagcaacataatgctttgggagataagcaggtagtaagtactgaggagggc
aaaaccaacgtagccatgcaggaagacagtaaaaacaaagagcaaggtgctgttgattct
caggaggaaatcaaaaccgtcgaagatactgtaatacatgctaacagttcttggagcaaa
atatccagcattgcacctgcttcagaaaacaaaagtgaaacagataacaaagctgacaga
tctgataaaagtgtcttcatggtaactgaacagaaggcacaggaatccaggcatcacaaa
aagaattctatgcccaatactgatacaactgattatatggaagaggaagaagatgatgat
gatgatgaagatgaaaaaactgatgattctgctgatgagatgctggatggtgcttctgat
ttctcaagtgaagaggaaatagatgttgaaaaagtggatgcgtgtgaatacagtgaggat
gacgagcaggtggacattgagaccgtggaggagctttcagagaagattaacattgcccgt
ctgaaggccacagctgctaatatccgaccttccaaagagaaataccatgctcgtaattct
tcggatgaaaaattatcagaaagtcctacgaagcagaatcctccagtttggagcagaagg
cagaagtctgaggaagaagcttttgctcattaccgccagacacacacagcaaatgaacgc
cggcgacgtaatgaaatgagagatctctttgagaaactgaagagagctctggggctgcac
agtcttcccaaggtgtctaaatgctacattctcaagcaagccttggatgaaatccaggga
ttgactgatcaagcagataaacttactggacagaagtgcatactggcgcgcaaacaggat
actttgattcgaaaagtttccatactttcagggaagacagaagaggttgtcctaaagaag
ctagaatatatgtatgccaaacaaaaagccgtagaagcacaaaaaaagaagaaaaatgtt
cagccaacagaatctgttgtaacctcacctgctagcacacatcaagaagcatcttctgct
ctacccagagatctgagcaaagtgcctatgacaagtagaagaggcaagccattgatactt
gccagaaaaggaagccatgccacagagaacacctcatcctctctaacactaactgctgca
agcctagtgatgactccccaggggcaggtgctcacgttgaagagcccactggtacccggg
caggtagcagctgtgccctccacgctcctgcaggctgaactaaagcctcgagctgtcagc
aacaccatgacagcacagccaggtattgcttctgtgatgattcagctgccaggatcagcg
gttcctgtccaagtaaaaggaatccttgctaactctgccattcccattacactatcaact
gttgctggaaacccagcaccctcagcagtagtaccagcccctgagtcccattcagaaagt
gaagattcattcatgatgccaaagattgttaatgttacatcactggctgctgaagaaagc
ctgagtctcaacccgaacagaaacaaaaattctaacacgtcagctgcaagcgctcaggct
tctgagaagtctttggtaatgcctcttgaaagtaggaagagtgacagcatccttctagaa
gaaaaaaacaaaccatgtcctggagacagcgatggagagggaagaagcaccgcaggctcc
gcaaaaggtttctttgaaaataaggatggttttgcacagctccagaatgtatcgtgtgca
aaggaacctccagagtcttttggcaaaaagctctgcattggtgagctcgtaggaagccaa
gccaggaagaaggatggtgatcatgggggagaaagattaaaaacgaaagaactgccgttt
cgcaagctgcagatcaaagactcgaggatagaaatggaactgaggaaagtagcttctgct
atggaggaagcagaactggatgcaggtgagttactgagcagcattgaggagagtgatgac
actgatgagaccctcacttcgctgctcaatgagattgcttttctcaatcagcaactgaac
gatgacgcttcaggtatgtcagagctacccagcgctctaagctcagatttctcccatgga
gacgcagaggctcgccggggaacagccggtgatctcaccgccgcagatggttcttccttc
cagttcggccatctgggaggcgctttcaaagacctttctgaggttccagagggcagtggc
tctttaagccctctcttgctgcacctggaagatgatgaccttactgagggggacaagaac
tctggggagccttcgtctgaagcagatgttctaaaaatagtaataggtgctgaaatgaag
gatgcgcttcccaacctgtccgtaaccagtggcgggaatggcaaaactgtagcaaacttg
gcagaggccactggtgtgactcctccgattttgcagatgaaaactaatccggaagctagt
aatgctgacactttgtggaggcccatgccaaagctggcacctcttggcttaaaagtagca
agtctgccagtggactcagaagggcagagtgctaaagtgatgcccttgctggcacctata
gttgcaaaactggcacccgctgggggaaaagcttcatctgtaactgctcaagaaggacag
gataacaaagtaatgcctgcattagctcctgtgggtacaaaatttagtaattctggaacc
ctaccttcaaattcagttggcaaataa

DBGET integrated database retrieval system