KEGG   Gallus gallus (chicken): 423225
Entry
423225            CDS       T01006                                 

Symbol
SPTBN5
Name
(RefSeq) spectrin beta chain, non-erythrocytic 5
  KO
K06115  spectrin beta
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    423225 (SPTBN5)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     423225 (SPTBN5)
  Intermediate filaments
   Intermediate filament-binding proteins
    423225 (SPTBN5)
SSDB
Motif
Pfam: Spectrin CH PH CAMSAP_CH PH_9 HYPK_UBA
Other DBs
NCBI-GeneID: 423225
NCBI-ProteinID: XP_025007067
CGNC: 6790
Ensembl: ENSGALG00000008940
Position
5
AA seq 3946 aa
KVHRHIINTWSLFLNSKVALHENHKPNVGVQVNLELKVILQNDQLLNTRKELLLTSVTMN
SEYEKDHIKRLQEQRMFMQKKTFTNWMNNIFFRNNVGAEIENIYTDLKDGIYLMQLLELL
SGESLPRPNRGKMRVHFLENNSKAITFLKSKQVQVKVIGPENIVDGDRTLILGLIWIIIL
RFQISSIKLDKEEFGGRADQLFANEALLLWCQHKTASYPNVNVKDFSKSWSDGLAFNALI
HAHRPDLINYSSLRQDQPIKNLNNAFNVAEKELGISKLLDAEDVAVPSPDERSIMTYVSL
YYHYFSRMKQGQTNQKRLAKIVFLLKEIDDLKLLYEQMVSDLLKWIKQKVVELDDRVFPN
SLQEMWLLMANFKTFRTVEKPPKYQDKGMIEAHLFNIRTKQRANNLRLYVPPEGRTLQDV
EKHWIILEKAEHNRGKALQKEMLRLEKLEQLAKRFLKKAALRETYLEDMRKVIGKQDFWP
ESVDRMEAASKKLEAIVADVLPRRERFASLAEMATVISQNNYHSKDQIVKKENSISKQWQ
DLLDQLQKRQHSLSTMQEILALLRDIDAIMEELKELQALVNSQDCGKQLLEVVDLLQKHN
LIDLQISSYDDKLTHITQRTAEISKDSTVKAEVLYAKVPMLRQLYQNLIAQSRTRKSQLE
EALKLFEFFRDCKEEEAWISEKWKIARTTTLGKDVSQITASIQKHKALEAECNSHRAICA
DVMRRGWDLSQKNPTHEENIQKQRDKLQTLWQQLQDEVANRKNRLQAAALIKQYFADIDE
ANSWLQERQTLVASKDYGKDESSAEALLHRHLRLEKEIAAYSTEMRRLKEQAAIAAEQAP
AAMVKTEAPDDLNQKTAKLPFSRTWATSESALPGSSSLDIHFVPENIWKTQDEIDSLYEN
LQSMAEDRKKALEEMIEYYRFCSSCEAFQSWMREKENIFRTLQPQADNVEVMQQKYQSFL
TELAAGKGQLGEIESLATKFGKNSPGKYTEIQIWLKEIHARWQHMESLKEEKGSELIGVA
DVRTFLEDCQSIGVLLQDKMGQLRNLEPGNSPAGLESDKRKLSVVEREILVIERKIEYLR
SVAKSIKDTNPAESKAITVQVENMESLLVNLKLETQRKRDLLQQAQNQQSFLQDSRRLLL
WAEGIREKLRSEEMGVDVASAEHLLREHQDLLKEIRSQKERFLQLEELGRKIIQKQPSNS
RTRDVHLSVERLAEENKELENMWEQRWKKLQDGLELQKFNREGDRINAALSSHEAFLRGD
DLGDHVDAVRSLQKQHQEFEQLLMVLKRRIEAFNENGADLIESGHFASHAIKERMATLRQ
RWERLVENNSKRKQRLLDSLQLQEFNRDAAELLIWMEEKYKIASDESYRDPTNVLRKLKW
HEAAEKEMMANEKHFITLIKKGNQLIQDDHYAAASIQKKMSELEKKWKELYGKMIERGDK
LRQAGQQEQLMELLQDAKKKIEKIEKVLQEAETGHDLRSSRDLLKQHRQLENETHELAEK
MNSIVSHAMKMATNHFDSQRILDETQKYLKRFESLQAPLDERRKLLEAAVDLYEFYHYHD
MELNWINERLPIASSTNCGKSLDVAQSLLQKHKEFQAEVNAHKQQVQRVLDKGRTMIVNQ
HPSAQKINEKCQELVTAWQGLEKACEERTKQLQHSVGFQEFLMNTSDLEAWIAEKRPLVM
SKDYGKDEDGTLKLLQKHKVLEHEIAVYQDLIKELNESVQNLPAMGSIQYVEVDAPREQV
HSRLRELQELAATRGKKLDETLVLHEFLREYEDLQDWMAQQKQAASSEDYGNNYEHVLQL
RAKYDTFRHQLEATGKRVMTCQQLAENLLNAGHSESREIRQKQKDLRNSWEELLEITRLR
GERLKDAEVIHKCYQDLTDALAHIEEKSKSIPDDVAKDMRGVQTQLRNHVALEHELLGNE
QQLQDLIHSADHVLTRCSNEQASGLKAKQQAIVTNWKALKSKVQLRKELLEQAHKLYQFQ
AQVWDYFSWTSEMIREMRAKETIRDISTSSLRLTQHQQLLAEIEAQEEKYNQIVQLGQSL
LQDEEIRSKEIRQKLQALLEEKDKVYSEWQQKKKWLDRIHQEQMFYKDWNHLDKLLNSQE
VYLKSSDLGSSVDEVEQLIRKHEAFEKLLASQDEKITSLQEQANKLEKDGGLDGVQIQHK
LDTILQRKKQIKNLSRSRREKLQTALLLALFYQNLAEAEDWISERMQKLEDPSIQDPSNL
QDKMKLLQKHQVFEAEILANEEIITDVNKKGEALVSMGHPKSGEIRRQVRMLQERWEKLK
RAVAARGKMLEDSRDFLEFLQKVDQVEAWIREKEVMINIGDVGNDYEHCLQLIRKLNEFR
GATSGETTVDDAHIKAINALAMKLERQNKEETKTIYQRRKQLNEKWNSFHGNLNAYRRKL
EGALEIHALIREIDDITERITEKSVLIQALDYGKDVESVENLIRRHEEMEREINVIKSKI
EPLELESFRLSTRNPSINDKLTMKQQEMKNNWLRLQGQAKQRKEKLAASYQLQKFNSEMK
EITDWIQNIRGLMEAGGLPKSLNEAESMIEEHQQRKEEIEARVERFNSLSNYGQQLANSG
HYATPEIHQSLSRLQKAWTELIQAWQEQYIKLFQAQDLQKFYGYVEQTESWLSSKEAFLA
NEDLGDSVSSVESLQRKHMQFEKSLEAQMEKIDEMASFAQQLIQNKHYDSDNITNRCQAV
LRRKEKLLENAAARRHLLEESRLLQKLLKNSYEVATWINEKNSIAQDDSWRDPSNLQTKL
QKHQSFQAEIMANKNRLDSIKSEGEKMIRERHYAPEAIQSRLQEMEELWEELLASCQDKR
AKLQDAYKALHFQRSIEDTEKWLEDVENELKAPYSSDDLVVLNSHLKKQEELEQDIASHR
DRLQELVNTAQEFQQEKHFLADELEERVDQLVQRYKSLRDPLQERRGSLEASRLQYEFFR
DVDEELAWVHEKLPMASSRDYGQSLATVQSLQEKHQNLENEISSRDALTKAVLSTGQKLV
RGGHSASRKIMEQMKELETSVENLKAEAHVRRQRLMQSYEAHQFLTELLDVETWLAERSF
ILETSDYGKNEESTQALLRKLEATKLDMEGFRPRIEKVQETGASLINKDNPESPAILSKL
QRILADYQSLLQKAETQRKRLQEQFQLYQFEREFQLVDAWLSSKQSIAESDDYGQDLDGV
EVLEKKFKDFVNEIKPLGHSKVLSLNELASKLEKDGHSKTDIIQKRTKQINEMWEKLCHA
IQTRTENLRAAQQVHQYDHDVDEVKGWMQEKEAVVDIDDYGYDLPGVQTLLSQLEGVERD
LGAIMKELERIRGEAWHLSRTYPQLKENIMERLTDVDECWRNLDKKFLERKARLSQAEQV
QLYFNDCRELMAWANEMHALVISEELANDVLGAELLIKRHDEYKREIEKQWLKYEEIQRA
GDDLTRNGHFMSVEIEEKLLELSELMKKVKESWNVRKELYEENWEIQLLRRELEQAEAWL
AAKESFLSDPSYGDSVSEVEELLKKHHDFENMLAAQEEKFAQLSRKTKREMNLLKQTDAE
ESEQKDKGKIVRVPSLKRKTSDKRNPPPKVIEIRNTKPLESVQPPLLSWTPLETIFSPVE
KPAVAFQQFASGKVPEVLSSKKPEMKPERRLSETITPPTPKTVDPQATSLTHHSSLTSPL
SPTPISLQRSSNFSESYATGLLSPQEKSAESSSFSNLQTKLAATSPKPDQKSFDKSPDLL
LSRSSRETSETAPLVSASLQHMEGFLEKRDQLLPGRQQPGSRSWKSFYVKLDGLQLDFYN
DEQEASKNISTLLSLSIVGAKCERLTNYIRKENTFMLRLRDGAEYFFAAPSPMLMENWLQ
SLQNNIGHRNRPDSTVMVRPFTPSTEPSQTDLWDRDSAERLTSKSTLLRRTPSFRIKPEK
ESAAFFRNLKEDGTAVTQASTTTLNLEQGGNNTELPPSLLEAGREK
NT seq 11841 nt   +upstreamnt  +downstreamnt
aaggttcataggcatatcataaatacttggtctctgttcctgaattcaaaggttgctttg
catgaaaaccataagccgaacgtaggagtacaagtgaatttagaactgaaagtcattctc
cagaatgaccaactgctgaacacgagaaaggagctcctcctgacctcagtcaccatgaat
agtgaatatgaaaaagatcacatcaaaaggctgcaggagcagcgtatgttcatgcaaaag
aaaaccttcaccaactggatgaataatatcttcttcaggaataatgtaggggctgaaata
gaaaatatttacacagacctgaaggatggcatctatcttatgcaactcctggagctgctc
tctggagaatctttgcccagaccgaaccggggaaagatgagagtgcattttctagagaac
aacagcaaagccattacatttctgaaatccaagcaggtgcaagtgaaagtgattggtcct
gagaatattgtagacggtgacagaaccttaatcctgggactcatctggataattatactt
agatttcaaatttcatctatcaaacttgataaggaagaatttggaggtagagctgatcag
ctatttgccaatgaagccctactactttggtgtcagcataaaactgccagctatcccaac
gtaaatgtgaaggacttctctaaaagttggagtgatggactggctttcaatgcacttata
catgcccacaggcctgatcttatcaattatagctcactgcggcaggaccagcccatcaaa
aacctgaacaatgcctttaatgttgctgagaaagagctagggatcagcaagctgcttgat
gctgaggatgtggcagtaccctccccagacgagagatccatcatgacttatgtgtcactc
tattaccactacttctccagaatgaaacaaggccagacaaatcaaaagcgacttgccaaa
attgtgttcctcctgaaggagatagatgacttgaagcttctgtatgagcagatggtctct
gacctcctgaaatggattaagcagaaggtggttgagctggatgaccgtgtgttccccaac
tctcttcaggaaatgtggctgctcatggccaatttcaagaccttccgcactgtggaaaaa
ccccctaaatatcaagataagggcatgattgaagctcatctcttcaatatcaggaccaag
cagagagccaacaacctacgactatatgtgcctccagaggggaggacactgcaggatgtg
gaaaagcactggattatcctggaaaaggcagaacacaaccggggaaaagcactgcagaag
gagatgctgaggctagagaagttggaacagctagccaagaggtttctgaagaaggcagct
ctgcgtgagacttacttggaagacatgaggaaagtaattggaaagcaagacttctggcca
gagagtgtagataggatggaagctgccagtaagaagctggaagccattgtggcagatgta
ctccccaggagggaacgcttcgcatctttggccgaaatggcaacagtcatcagccagaat
aactatcacagcaaagatcaaattgtgaaaaaggaaaacagcatttcaaagcaatggcaa
gatcttctggatcagctgcagaaacgacaacactccctgagtacaatgcaggagattcta
gccctcctgagggacattgatgccattatggaggagctgaaagagctgcaggcactagtg
aattctcaggactgtgggaagcagctcctagaagtagtagatttgcttcaaaagcacaac
ttgattgacttgcaaatctcttcctatgatgataaactgacacacataactcaaaggaca
gcagaaatcagcaaggatagcacagttaaagcagaagtgctttatgcaaaagttccgatg
cttcgtcagctatatcagaaccttatagctcagagcagaacacgaaaatcccagctagaa
gaggctttgaagctctttgaattcttccgtgactgcaaagaggaagaagcatggatctct
gagaagtggaaaatagcaagaacaacaacattagggaaagatgtcagccagattacagct
tccattcagaagcacaaggctcttgaagcagaatgtaactcgcacagggccatttgcgca
gatgtgatgaggaggggctgggatctgagccagaagaaccctacacatgaggagaacatc
cagaaacagagagacaaacttcaaacattgtggcagcagctccaggatgaggtggctaat
cgcaaaaaccgcctgcaggcagcagctctcatcaaacagtactttgctgacatcgatgaa
gcaaattcatggttgcaagaaaggcaaacccttgtggccagcaaggactatggaaaagat
gaatcaagtgctgaagcgctgttgcatcgtcatttgcggctggaaaaggagattgcagcc
tactccacagagatgaggcgcctgaaagagcaggctgccattgcagcagagcaagctcca
gctgcaatggtgaagacagaagccccagatgacttaaatcagaagacagctaagctacca
ttcagtcgaacctgggctacctctgaatctgcacttcctggaagctccagtttagacatt
cattttgttccagagaacatttggaagacccaagatgaaatagactcactttatgaaaac
ctacagagcatggctgaggacagaaaaaaggctttggaggagatgattgagtattaccgc
ttctgtagctcctgtgaagcatttcagtcatggatgagagaaaaggaaaacatttttagg
actcttcagcctcaagcagacaacgtggaagtcatgcaacaaaagtaccagagtttttta
acagaactggcggcagggaaaggccagctgggagaaattgaaagcttagctactaaattt
ggaaagaacagtcctggcaaatacactgagatccagatttggctgaaagaaatccatgcc
aggtggcaacatatggaatctctgaaggaggagaagggctcagagctgatcggagtggct
gatgtgaggacattccttgaagactgtcagagcataggagtgctactgcaagacaagatg
ggccagctcaggaatctggaaccagggaactcacctgctgggctggagtctgacaagcgc
aaactgtctgtagtggaaagagagatcctagtgatagagaggaaaattgaatacttgagg
agtgttgcaaaatccattaaggacaccaaccctgcagagagcaaggccatcacagtgcag
gtggagaacatggaaagtcttctggtaaacctgaagttggagacccaaaggaagcgtgac
cttctgcagcaggcccaaaatcaacagtcctttctgcaagacagccgcaggctcctgctg
tgggcagaaggcatcagggagaagctgagaagtgaagaaatgggtgtggatgtggcttct
gcagagcatctgctgagggaacatcaggaccttctgaaagaaataaggtctcagaaggaa
agatttctacagctagaagagcttgggcgtaaaataatccaaaaacaacccagtaacagt
aggaccagagatgttcacctgtctgtggagaggcttgccgaggagaacaaagagctggaa
aatatgtgggaacagcgatggaaaaagttgcaggatggcttggaattgcagaagttcaac
agggagggagaccgtatcaatgctgccctttctagccatgaggcttttctccggggtgat
gaccttggggatcatgtagatgctgttcgaagcctgcagaaacaacatcaggaatttgaa
caactgttaatggtgctaaagagacggattgaagcatttaatgaaaatggggcggaccta
atagaaagtgggcactttgcatcacatgctattaaagagagaatggctacactccggcaa
agatgggaacgactggtagagaacaattccaagagaaaacagaggttgttggattccctg
cagctgcaggaattcaaccgtgatgctgctgagcttttgatatggatggaagagaagtac
aagattgcatctgatgaatcctatcgtgatccaacaaatgttttacgcaaactgaagtgg
catgaggctgctgagaaggaaatgatggctaatgagaagcacttcataacactgataaag
aaaggaaatcagctgattcaagatgaccattatgctgcagcttctatccaaaagaagatg
tcagagctagagaagaagtggaaagaattgtatgggaagatgatagagcgaggtgacaag
ttaagacaagctgggcagcaagaacagctcatggaactgctgcaggatgccaaaaagaag
atagagaaaattgagaaggttcttcaggaagcagagactggccatgatttgcgctccagc
cgtgatctactcaagcagcacaggcagctggaaaatgagacacacgagctggcagagaaa
atgaactctattgtgtctcatgcaatgaaaatggccaccaaccactttgactcccagaga
attttggatgaaacgcaaaaatacctaaaaaggtttgagtctttgcaagcacctcttgat
gagaggcgtaagctgctggaagctgcagtggatctttatgagttctaccattaccatgac
atggagctgaactggattaatgagcgactgcctattgccagttccaccaactgtgggaag
tccttggatgtggctcaaagtttgttgcaaaaacacaaggaatttcaggcagaagtgaat
gcccacaagcagcaagtccagcgggtcctggataaaggaaggacaatgattgtaaaccag
catccatcagctcagaaaataaatgagaaatgccaggaacttgtgactgcctggcagggc
ctggagaaagcctgtgaggaaaggacaaagcagctgcagcactcagttggtttccaagag
tttctaatgaatacttcagacctggaggcttggatagcagaaaagcgtccacttgtgatg
agcaaggactatggtaaggatgaagatggaacattgaaactcctccagaaacataaggtg
ctggagcacgagattgctgtttaccaagatctgattaaagaactaaatgaaagtgtccaa
aatcttcctgccatgggttccatccagtacgttgaggttgatgcaccacgtgaacaagtt
cactcaagactccgtgagttgcaggaactagcagcaacaagagggaagaagctggatgag
actcttgtcttgcatgaattcctacgagaatatgaagatctgcaggactggatggctcag
cagaaacaagcagccagctctgaagactatggaaataattatgagcatgtcttgcaactt
cgtgccaaatatgacactttccgacaccaattggaagcaactgggaaaagagttatgact
tgccagcagctggcagagaacttgctaaacgctggtcattctgagtcccgtgaaatccgg
cagaagcagaaagacctaagaaactcttgggaggagctgttagaaattaccagattacgc
ggtgagcggctgaaagatgctgaggtgattcacaagtgttaccaagatctgacagatgct
ctggcccacattgaggagaagtccaaaagtattccagatgatgttgcgaaggacatgaga
ggtgtgcaaacccagctccggaaccatgtggccctggaacatgagctccttggaaatgag
cagcagctgcaggatctgatccactctgcagatcatgtgctgactcgttgctcaaatgag
caggcgtcaggcctgaaagcaaagcaacaggcaatagtgactaactggaaggccctgaag
tctaaagtgcaactgcgtaaggagcttctggaacaagcacacaagctttaccagtttcag
gcacaagtgtgggactatttctcatggacatcagaaatgattagggaaatgagagccaag
gagactatccgggacatatctactagcagcctgagacttacccagcatcaacagctactg
gctgagattgaagcacaagaagagaagtataatcaaattgtacagcttggacagtcactc
ttgcaagatgaggaaataagatcaaaagagattcgtcagaagctacaagctctgttggaa
gagaaggacaaagtatacagtgaatggcaacagaagaagaagtggctggacagaatacat
caagaacaaatgttctacaaggattggaatcacctggacaagctcctgaactcgcaggag
gtttatttgaaaagcagtgaccttggaagctctgtagatgaagtagagcaactgattagg
aaacatgaggcatttgagaagctactggcatcacaggatgagaagataacgtctcttcaa
gaacaagcaaacaagctagaaaaggatggtggattggatggggtacagattcagcacaag
ctggacaccattcttcagaggaagaagcagatcaagaatctctcccggagcaggagagaa
aagctgcagaccgcccttcttctggcacttttctatcagaacttggcagaggcagaagac
tggatcagtgagcgcatgcagaagctagaggatccttccatacaagatcccagcaatctg
caggacaaaatgaagctgctgcagaagcatcaggtctttgaggcagagattctagcaaat
gaagaaatcatcacagatgttaataagaaaggagaagccctggtttcaatgggccaccca
aaatcgggggagatccgccgccaagtccgcatgcttcaggagcgctgggagaagttgaag
agagctgttgctgcccgtggaaagatgctggaggatagtcgagatttcctggaatttctc
cagaaagtggaccaggtggaagcctggatcagggaaaaggaagtcatgattaacataggt
gatgtgggaaatgactatgaacactgtctgcagctcatcagaaagctgaatgagttccgt
ggagcaacatcaggggagacaacagtggatgatgctcacatcaaggctatcaatgccctg
gccatgaaactggagagacaaaacaaggaagagacaaagacaatatatcagcgccggaag
cagctcaatgagaagtggaacagtttccatggtaacctgaatgcatacaggaggaagtta
gaaggagctctggagattcatgccttgatcagagaaatcgatgacatcacagaaagaatt
actgagaagagtgtcctgatacaagcactggattatgggaaagatgttgaaagtgtggaa
aaccttattcgaagacatgaagagatggagagagaaatcaatgttattaagtccaaaata
gagccattggaattggaatctttccgcctttccacaaggaatccatccataaatgacaag
ctgactatgaagcaacaggagatgaaaaacaactggctacgactccagggacaggccaaa
caaaggaaggagaagctggcagcctcatatcagttgcagaagtttaactctgagatgaag
gaaattacagattggattcaaaacatcagaggcttaatggaagcaggggggcttcctaaa
agcctaaatgaagcagaaagcatgattgaggagcatcagcagagaaaggaggagattgaa
gcacgagtggaaagattcaactctctcagtaactatggtcaacaacttgccaattctggt
cactacgcaacccctgagattcatcagtctctctccagactacagaaagcctggactgaa
ttgatccaagcatggcaggagcaatatataaaattgtttcaagcacaagatttacagaaa
ttctatggctatgtggaacagaccgagagctggctcagcagcaaagaggctttcctagcc
aatgaagacttaggggactcagtgtctagtgtggagagcctgcaacggaaacacatgcaa
tttgaaaaatccctggaagctcagatggagaaaattgatgagatggcttcatttgcccag
cagctaattcagaacaaacattatgactcggacaacatcaccaacagatgccaggccgtt
ctgaggagaaaagagaaattactggagaatgctgctgctcgcagacatctactagaggaa
tcaaggcttctgcagaagttgttgaagaattcctatgaggtggctacctggatcaatgag
aagaacagtattgctcaggatgatagctggagggatccaagcaatctacaaaccaagctg
cagaaacatcaaagtttccaagcagagatcatggccaataaaaatcgcctggactccatc
aaatctgaaggagagaagatgatccgtgagagacactatgcccctgaggccattcagtct
aggctacaagaaatggaagagctatgggaggaactgctagcaagctgccaagataaacga
gccaagctgcaggatgcttacaaggcccttcattttcagcggagtatagaggatacagaa
aaatggttggaagatgtggaaaatgagttgaaagcaccatatagcagcgatgatctagtg
gttctgaacagtcacctgaagaaacaagaggaactggagcaagatattgctagccatagg
gaccggttgcaagagcttgtgaacacagctcaggaattccagcaggaaaagcatttcctt
gccgatgagctagaagagagggtcgatcagctggtgcaaagatacaaaagtctacgtgat
cctctgcaggagagacgcgggagtttggaggcaagcagacttcagtacgagttcttccga
gatgttgatgaggagttggcctgggttcatgagaaacttcccatggcatcctccagggat
tacggccaatccctggcaactgttcagagtctacaggaaaagcaccagaatttggagaat
gagataagcagtagggatgccttgaccaaagcagtgctcagtactgggcagaaactggta
aggggaggccactcagcctctcgcaagattatggagcagatgaaggagctggagacatct
gtagaaaacttgaaagcagaggctcatgtgaggagacagcgtctcatgcagtcatatgag
gcccatcagttcctgactgagctactggatgtggagacctggctggcagagaggagcttc
attctggagacttctgattatgggaagaatgaagaatccactcaagctttactacgtaaa
cttgaagccaccaagctggacatggagggttttaggccccggattgagaaagtacaggag
acaggtgccagcttaataaacaaagacaacccagagagtccagccatactttcaaagctc
cagaggatcctagcagactatcagtctctcctacaaaaggctgagacccagagaaaacgc
ctgcaagaacaattccagctgtatcagtttgaaagagaattccagctggttgacgcctgg
ctttccagtaaacagtctattgcagagtccgatgactatgggcaggacttagatggtgtt
gaggtgctggagaaaaagtttaaagattttgtaaatgagattaaacctctgggacattcc
aaagttctctccttaaatgaattagcatctaaactagagaaggatggccacagcaagaca
gatattatccagaaaaggacaaaacaaattaacgagatgtgggagaaactgtgccatgcc
atccagacaaggacagagaatctgagagcagcccagcaagttcaccagtatgaccatgat
gtggatgaagtaaagggctggatgcaggaaaaggaggctgtggtggacatagatgattat
ggatatgatcttccaggtgtacaaactcttctgagccagcttgaaggagtggagagagat
ctaggagccattatgaaagagctggaacggattcgaggagaagcctggcacctcagccgc
acatacccacagctcaaggaaaacattatggagagactcacagatgtggatgagtgctgg
agaaacctggataagaagtttctggagagaaaggcgagactgagccaggcagaacaagtc
cagctctacttcaatgactgcagggagctaatggcatgggccaatgagatgcacgcacta
gtgatatctgaggaactagcaaatgatgtcctgggagctgaactgcttatcaaacgtcat
gatgaatacaagcgtgagatagagaagcagtggctcaaatatgaagaaatacagcgggca
ggagatgacctgacaagaaatggacatttcatgtctgtggagattgaagaaaaactgcta
gagctgtcagagctgatgaagaaagtaaaggagagctggaacgtgaggaaagagctgtat
gaagaaaactgggagattcaactgctccgcagagaactagaacaagcagaagcatggctg
gctgccaaggagagctttctttcagaccctagctatggggattctgtgtctgaagtagag
gaactactgaagaaacatcatgactttgagaacatgcttgcagctcaggaggagaaattt
gctcagctcagcaggaaaactaagagggagatgaatcttctgaaacagacagatgcagaa
gaaagtgagcagaaggataaaggcaaaattgtacgggttccttctctgaaaagaaaaaca
tctgacaaaaggaatccaccaccaaaagtgatagagataaggaatacaaagccactggaa
tctgtgcaaccaccactcctgtcctggactccacttgaaacaattttctctccagttgaa
aagcctgcagtggcattccaacaatttgcttctgggaaagtccctgaggtgctgagcagc
aaaaaaccagaaatgaaacctgagaggagactcagtgagactatcactccacctacacca
aagacagtagacccacaagctacatctttgacacatcacagttctttaacctctccttta
tctcctactcccataagcctgcaacgcagcagcaatttctcagaatcatatgccacaggc
cttttatcacctcaagaaaaaagtgctgaaagctcctccttctccaacctgcaaacaaaa
ttagcagcaacatcacccaagcctgaccagaagtcatttgataaatcaccagatttactg
ctgtctaggtcctcacgggagacatcggagactgcacccttggtttctgcaagtctccag
catatggaggggttcctagaaaagagagaccagcttcttccaggacgacaacagccaggc
tcaaggtcttggaaatccttttatgtaaaacttgatggactacagcttgatttctacaat
gatgaacaagaagcatctaagaatatatccacactcctgtccctcagcattgttggtgcc
aaatgtgagaggctgacaaactacatcaggaaagagaacaccttcatgttacgactgaga
gacggggcagagtatttctttgcagcaccttctccgatgctgatggagaactggttgcag
tcactgcagaataatataggacatagaaacaggccagattctacagtgatggtgaggcct
ttcactccaagcactgagccctctcagacagatctgtgggacagagactctgctgaaaga
ctaaccagcaaaagtacactcctaaggagaacaccatctttcagaatcaaaccagagaag
gaatctgcagcatttttcagaaatttaaaggaagatgggactgcagtgacccaagcctcc
accaccactctgaacctagaacaaggtggtaataacacagaactgcctccatctctacta
gaagcaggaagagaaaaataa

DBGET integrated database retrieval system