KEGG   Gallus gallus (chicken): 423229Help
Entry
423229            CDS       T01006                                 

Gene name
PLA2G4EL1
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00564  Glycerophospholipid metabolism
gga00565  Ether lipid metabolism
gga00590  Arachidonic acid metabolism
gga00591  Linoleic acid metabolism
gga00592  alpha-Linolenic acid metabolism
gga01100  Metabolic pathways
gga04010  MAPK signaling pathway
gga04217  Necroptosis
gga04270  Vascular smooth muscle contraction
gga04370  VEGF signaling pathway
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    423229 (PLA2G4EL1)
   00565 Ether lipid metabolism
    423229 (PLA2G4EL1)
   00590 Arachidonic acid metabolism
    423229 (PLA2G4EL1)
   00591 Linoleic acid metabolism
    423229 (PLA2G4EL1)
   00592 alpha-Linolenic acid metabolism
    423229 (PLA2G4EL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    423229 (PLA2G4EL1)
   04370 VEGF signaling pathway
    423229 (PLA2G4EL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    423229 (PLA2G4EL1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    423229 (PLA2G4EL1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    423229 (PLA2G4EL1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     423229 (PLA2G4EL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 423229
NCBI-ProteinID: XP_015142595
CGNC: 66451
Ensembl: ENSGALG00000043401
Position
5
AA seq 845 aa AA seqDB search
MGSSAYSPLDQFIQANPHRKVGIRKGNRGRPCSTEDEPEIPQLRWLTVKIIGMRNLRKAD
LLSQTDCYVRLWLPTASHQEARTRTVSNCRNPVWNETFHFMIQSEVKNVLELTVCDEDTI
TPDDQLLTVRFDVAKIQPGEKVRLSFELNPENREELEVEFLLDNIPGVSEKIVTNGVLVS
REVSCVEVQVDDTRMKTPYTRRDFTFAMKGSYEETRNISMGPSCSQRDSDSTMFHYIKYS
QPNLDMVLPKERLYCGHDANRREKDINSPLSVPLNSLDRGKKMTVVRGASYEVSVKEEDG
SKNLDLRLGFDLCAEEKDFICKRKKVVAAALKNVLQLDEDLQEDEQVPVVAVMTTAGGVR
SMTSMFGSLLALQELGVLDCISYISGLSATTWTMAKLYEDANWSQKDLRGPIDDIRKYVI
KSKLHCFSTDHLKYYEKELCERKLEGHKLSFTDLWGLFIDSMLHNEENTHKLSDQQLAVN
QGQNPLPIYLSLNVRDKFSTLDFKEWVEFTPYEVGALKYGAFVRSEDFGSEFFMGHLMKK
IPESRICFLEGTWSNIFSQSFMDVVYLSGHSEDFWHRWTRGTEHDIEEHPALPTRPHEQT
TCLSLPKGYLSNALREMMTGRPVVSYYHNFIKGLQLHNKYLENESFCMWKDTVLDSSPNQ
LNAMGDYLKLVDTAFFINTSCPPFLRPERKVDVILHLNYSGGSQTLPLDLFSEYCLEQGI
PFPCTELSCEDREHLKECYVFEDNLEAPILVYFPLVCDTFQRYKAPNVERSPAEMEKGRV
DVSNCFAPYGTGQLTYTEGNFNKLLNLCNYNILNNKRLILQALKTAVERKKRFKNCSPPQ
SSELS
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgggatcctcagcctactcacctctggatcagttcatccaagcaaacccacacaggaaa
gttgggatcaggaaggggaatcgtggaagaccatgcagcactgaagatgagccagaaata
cctcagttgcgttggcttactgtaaaaattataggtatgagaaatctccgcaaagcagac
ctgttgagccaaactgactgctacgtgaggctgtggttgccaacagcttcacaccaggaa
gcccggacgagaactgtatccaactgcaggaaccctgtctggaatgaaacttttcacttc
atgatacaaagtgaagtgaagaacgtgctggagctgacagtctgtgatgaagacaccatc
acacctgatgatcagcttttgactgtacgctttgatgtagctaaaatccaacctggagag
aaggttcgcctgagttttgagttgaatccagagaatcgggaagaactagaagtggaattt
ctactggataacattccaggtgtatctgaaaaaatagtcactaatggtgtgctagtgtct
cgagaagtttcctgtgtggaagtgcaagtggatgacacaaggatgaagactccttacaca
aggagagatttcaccttcgcaatgaagggatcctatgaagaaactcggaacatttccatg
ggtccttcctgtagccaaagagacagtgattctaccatgttccactatatcaagtacagc
caacccaacctggacatggtgttgccaaaggaacgtctatactgtggtcatgatgcaaac
aggagggaaaaggatataaacagtcctctatctgtacctctgaattctctggaccgggga
aagaaaatgacagtagtgagaggtgcatcttatgaagtgtctgtgaaggaagaagatggt
agcaagaatttagatttgcgcttggggtttgatctatgtgcagaggaaaaagatttcatc
tgtaaaaggaagaaggttgttgctgctgctctaaaaaatgttcttcaactcgatgaagac
ctgcaggaggatgagcaggtgccggtggtggcagtcatgaccacagcagggggagtgcgg
tccatgacgtcaatgtttggcagtcttctagctctacaagagttaggtgttttggactgc
atctcatacatcagtggtctatctgccacaacatggaccatggcaaaattatatgaagat
gcaaattggtcacagaaggatctcagagggccaattgatgatattcggaaatatgtgatc
aagagcaaattgcactgtttctctacagatcatctgaaatactatgagaaggagttgtgt
gaaagaaagctagaggggcacaagctctctttcacagatttatggggactcttcattgac
tctatgctacataatgaggaaaatactcataaactctctgatcagcaactggcagtgaat
caggggcagaatccactgcccatttacttgtctctcaatgtcagggataaatttagcact
ctggattttaaagagtgggtggagttcacgccttatgaggtaggtgccctgaaatatggg
gcctttgttcgttcagaggattttggtagtgaatttttcatgggccacctgatgaagaag
atcccagaatcccggatctgcttcttggaaggcacatggagtaatatattttcccagagt
tttatggatgttgtctacctctcgggtcattcagaggacttctggcacagatggactcga
ggcactgagcatgacattgaggagcaccctgctctgcctacaagacctcatgagcaaaca
acttgcttatcccttcccaagggttacctttccaatgctcttcgagaaatgatgacagga
cgtccagtggtttcatactatcataatttcatcaagggcttgcagctgcataacaagtat
ttagagaatgaaagcttctgcatgtggaaagatacagtgcttgattcttctcccaaccaa
ctgaatgcaatgggtgactacctcaagctggtagatacagctttcttcatcaataccagc
tgcccaccatttttgaggccagagaggaaagtggatgtcattttgcatttaaattacagc
ggaggatcacagactctgccactggacctattctcagagtactgcttagagcaagggatc
ccatttccctgcacagagctgagctgtgaggatcgggagcacctgaaggagtgctatgtg
tttgaggacaacttagaggcaccaatcttggtctatttcccacttgtgtgtgataccttt
caaagatacaaggcaccaaatgtggagcgcagtcctgcagagatggagaagggaagagta
gatgtgtccaattgttttgctccctatggcactggtcaacttacatatactgaagggaat
ttcaacaagctgttgaacctctgcaactacaacatcctgaataacaaacgtttgattctt
caggctttgaaaactgcagtggaacggaagaagcgatttaaaaattgctcaccacctcag
tcatctgaactctcttaa

DBGET integrated database retrieval system