KEGG   Gallus gallus (chicken): 423316
Entry
423316            CDS       T01006                                 

Gene name
EGLN3
Definition
(RefSeq) egl nine homolog 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     423316 (EGLN3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 423316
NCBI-ProteinID: XP_421233
CGNC: 7601
Ensembl: ENSGALG00000010001
UniProt: E1C8C0
Position
5
AA seq 241 aa
MPLGHIMRLDLERLALEYVVPCLHDIGFCYLDNFLGEVVGDCVLERVKRMHRDGELADGQ
LAGPSRGVAKRHLRGDQIKWIGGTEEGCEAINFLLTLIDRLVMYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDSKLHGGILRIFPEGKSYVADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTDARKREAALNE
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgccgctggggcacatcatgcggctggacctggagaggctcgccctggagtacgtcgtg
ccgtgtctgcacgacatcggcttctgctacctggacaacttcctgggggaggtggtgggc
gactgcgtgctggagcgggtgaagcgcatgcaccgcgacggtgagctggccgacgggcag
ctggccggccccagccgcggggtcgccaagcggcatctccgcggcgaccagatcaagtgg
atcgggggcacggaggagggctgcgaggccatcaacttccttctcacgctgatcgaccgc
ctggtgatgtactgcggcagccggctcggcaagtactacgtaaaggagcgctccaaggct
atggttgcttgttatcctggaaatggaactgggtatgtgcgtcatgtggacaacccgaat
ggtgatgggcgctgcatcacctgtatttattacctgaataagaactgggactccaagctc
catggtggaattcttcgaatattcccagaaggaaagtcctatgtagcagatgttgagcca
atttttgacaggttgctttttttctggtcagatcgaaggaaccctcatgaagtccagcct
tcttatgcaaccagatatgccatgactgtgtggtattttgatgctgaagaaagagcagaa
gcaaaaaaaaagttcaggaacttaactgatgcaaggaagagagaagcagctcttaatgaa
gactaa

DBGET integrated database retrieval system