KEGG   Gallus gallus (chicken): 423336
Entry
423336            CDS       T01006                                 

Gene name
GEMIN2
Definition
(RefSeq) gem-associated protein 2
  KO
K13130  gem associated protein 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    423336 (GEMIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    423336 (GEMIN2)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    423336 (GEMIN2)
SSDB
Motif
Pfam: SIP1
Other DBs
NCBI-GeneID: 423336
NCBI-ProteinID: NP_001034391
CGNC: 7719
Ensembl: ENSGALG00000010154
UniProt: Q5ZJH1
Position
5
AA seq 263 aa
MEPAVEELMPRLLPVGDCDLPDDFDPTVPPRTPQEYLRRVQIEAARCPDVVVAQIDPKKL
RKKQTVNIAISGCQPAPEGYSPTLKWQQQQVANFSSVRQSLNKHRNHWRSQDLDSNVNMP
KLEDEEGWKKFCLGERVYSEIDAESDHENLGIDYIKVGFPPLLSIVSRMNQATVTSVLEY
LISWFGEKKFTPELGRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRVLEENKNEEQVS
ALNLLICLVSRYFDQRDLADEPS
NT seq 792 nt   +upstreamnt  +downstreamnt
atggagccggccgtggaggagctgatgccgcggctgctgcccgtgggggactgcgacctg
cccgacgacttcgaccccaccgtgccgcccaggacgccgcaggagtacctgaggcgcgtc
cagattgaagcagcgcgatgcccagatgtggtcgtggcacaaatagaccccaagaagcta
agaaagaagcagacagtaaacattgcaatttctggatgtcagcctgctccggaaggatac
tctccaacactcaagtggcagcagcagcaagtggccaatttctcatctgttcgtcagagc
ctgaacaagcacagaaatcactggcggtcacaggatttggacagcaatgttaacatgccc
aaattagaggatgaagaaggttggaagaagttctgcctgggtgaaagagtatactcagaa
atagatgcagaatctgatcatgaaaatctaggaattgattacataaaggtgggctttcct
cctctgctaagtattgtaagcagaatgaatcaggccacagtaaccagtgtcttagaatac
ctgataagctggtttggagagaaaaaatttactccggaattgggtagatggttttatgca
ctgttggcatgccttgaaaaacctttgctacctgaagctcactcccttatccgacagctg
gcaaggcgatgctcagaagtgagagtactagaggagaacaagaacgaagagcaagtatca
gctctgaacctgttaatctgcttagttagcaggtactttgatcaacgtgatttagctgat
gaaccctcctag

DBGET integrated database retrieval system